KEGG   Corynebacterium pseudotuberculosis 316: Cp316_1889Help
Entry
Cp316_1889        CDS       T01753                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00430  Taurine and hypotaurine metabolism
cpg00620  Pyruvate metabolism
cpg00640  Propanoate metabolism
cpg00680  Methane metabolism
cpg01100  Metabolic pathways
cpg01120  Microbial metabolism in diverse environments
cpg01200  Carbon metabolism
Module
cpg_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cp316_1889 (ackA)
   00640 Propanoate metabolism
    Cp316_1889 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    Cp316_1889 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Cp316_1889 (ackA)
Enzymes [BR:cpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Cp316_1889 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFB73182
Position
complement(1978237..1979439)
Genome map
AA seq 400 aa AA seqDB search
MALVLVLNSGSSSIKFQLVDPTQHATDAPFASGLVEQIGEPKGKITLKHGGEKYVVEAPI
ADHTAGLDLAFKLMGEHGCGPKDVELEAVGHRVVHGGQVFSQPELITDEVVEAIRGLIPL
APLHNPANISGIEVARTLLPELPHVAVFDTGFFYSMPPASALYAIESETATKNGVRRYGF
HGTSHEYISQQVPKLLGKDPEDVNQITLHLGNGASAAAIRQGNPIDTSMGMTPLAGLAMG
TRSGDIDPGIIFHLYRTAGMSIDEIDDLLNKRSGVKGISGVNDFRELHQLIAEGNEDARL
AYKVYIQQLRRFIGSYMISLGRIDAITFTAGVGENDDAVRADALADLENFGIKIDLEANA
VRADGAREISTPDSTIKVFVVPTNEELAIARYAKTIAESV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggtcctagttctcaattcgggctcttcatcgatcaagttccagcttgtcgat
cccacccagcacgcaaccgatgccccctttgcatccggtcttgtcgagcagatcggtgag
cctaagggcaaaatcacgttgaagcatggtggcgagaagtacgttgtggaagccccaatt
gccgaccacaccgcaggcctggatctggcattcaagctcatgggtgagcacggctgtggc
cccaaagacgttgagcttgaagccgttggacaccgagtagtccacggtggccaggttttc
tcccagcctgaactgattactgacgaggttgtggaagcaatccgcggtctcatcccgctg
gctcctctgcacaacccagcgaatatctctggtattgaggttgcacgcacactcttgcct
gagctcccacacgttgccgtgtttgataccggtttcttctactcgatgcctccagcctcg
gcgctgtatgcgattgagagcgagaccgccacaaagaatggtgtgcgtcggtacggcttc
cacggcaccagccacgagtacatctcgcagcaggttcctaagctcttgggtaaggatcca
gaggacgttaaccagatcaccctgcacttgggcaacggcgcttctgctgcggcgatccgc
cagggtaatccgattgatacctccatgggtatgaccccattggctggtctggcaatgggc
actcgctccggtgacatcgatccaggcatcatcttccacctgtaccgcacggcaggcatg
agcattgatgagatcgatgatctgcttaacaagcgttccggtgtgaagggcatctcgggt
gttaatgacttccgcgagctgcatcagctgattgcagagggcaacgaggacgctcgcctt
gcttacaaggtctacatccagcagctgcgccgcttcatcggctcctacatgatatctctg
ggccgtatcgacgccatcacctttaccgcaggcgtaggcgaaaacgatgatgcggtgcgt
gcagacgctcttgcagacctagagaactttggtatcaagattgacctggaggccaacgca
gtgcgtgccgacggcgcccgcgaaatctccaccccagattccacaatcaaggtcttcgtg
gttcctacaaacgaggaactcgctattgctcgttacgcaaagaccatcgcggaatctgtc
taa

DBGET integrated database retrieval system