KEGG   Corynebacterium pseudotuberculosis 316: Cp316_2148Help
Entry
Cp316_2148        CDS       T01753                                 

Gene name
trpC
Definition
(GenBank) Bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cpg  Corynebacterium pseudotuberculosis 316
Pathway
cpg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpg01100  Metabolic pathways
cpg01110  Biosynthesis of secondary metabolites
cpg01130  Biosynthesis of antibiotics
cpg01230  Biosynthesis of amino acids
Module
cpg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp316_2148 (trpC)
Enzymes [BR:cpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cp316_2148 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Cp316_2148 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AFB73419
Position
2282690..2284276
Genome map
AA seq 528 aa AA seqDB search
MQNNVPMPTVLEEIVNTRRSHVQEISARISHINPLRLPRSTKSLFQALGGSINGGAASRR
QAYSSASTRAPHFIMECKSASPSLGTIRTDYSPGDIARIYSRYASAISVLCEPDKFNGDY
DHLATVAASTHLPVLCKDFIVDPVQVQAARYFGADAVLLMLSVLDDATYLSLSSEAERLG
LDVLTEVINEEEVKRGIRLGAKIFGVNHRNLHDLSIDLSRSSQLEPLIPENAVLVSESGI
KTNETVRQLAGHSDAFLVGSQLTSHSNIDSASRSLVYGTNKVCGLTTTSAAQNARAVGAT
HGGLIFENSSPRNVSRETAEKIIAAEPNLNYVAVSRRDHGWEEILLPEITSLQIHAPYQG
SIAGERALIDNARRELQKAGREDVSIWRAVSMTLPEGAATATALTDDVDMLLLDAGIGGT
GTSFNWEKITPDIAPKAILAGGLNLDNLPEALKTGCAGLDLNSGFEYSSTAGPWSGMKDS
GLLRQAFSKIRNFITSPIFHTHPLRSSLKTFRLLPMRYALNIWWWRAY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataatgtgcccatgcccacggttctagaagaaatcgttaatacgcgaagatca
cacgtccaagagatcagcgcgcgcatttcacatataaacccgctccggctaccgaggtcc
acaaagtccctttttcaggcgcttggaggttctatcaacgggggagcagcgtcgcgtcgt
caagcttattccagcgcatccaccagagcaccgcactttattatggaatgcaaatctgca
tcaccatcattaggcacaatccgtaccgactattccccgggagatattgcacgcatttat
tctcgatatgcttctgcaatttccgttctttgtgaacccgacaagttcaacggcgactac
gaccacttggccactgtcgcggcttccacgcatttgccggtcttatgcaaggactttatc
gtcgaccctgtgcaggttcaggctgctcgttactttggtgcggacgcggtcttactcatg
cttagcgtgcttgacgacgccacctacctctcactttctagcgaagccgaacgtctcgga
ctcgatgtgctcaccgaagtgataaacgaagaagaagtaaaaaggggtattcgtctcggg
gctaagatatttggcgttaatcaccgcaacctacacgatctcagcatcgacctttctcgt
tcctcacagctagagcctctcattccagaaaacgccgtattagtatcagaatctggcatc
aaaacaaatgagacagttagacaactagctggacattccgacgctttccttgtgggctcc
cagctcaccagccacagcaacattgactccgcctcccgttcactcgtttacggaaccaat
aaggtatgcggtctcaccacgacttccgcagcacagaatgctcgcgcagttggcgcaaca
cacggggggctaatttttgaaaactctagcccccgcaatgtttcacgtgaaaccgccgaa
aaaatcattgcagcggagcccaacctgaactacgttgcagtgagcagacgcgaccatgga
tgggaggaaatacttcttccggaaattacgagtctccaaatccatgccccataccaggga
tccatagcaggggagagggcgctcatcgataatgcccgtcgggagcttcaaaaggcggga
agggaagatgtctccatctggagagctgtgtccatgacacttccagagggggccgccacc
gctaccgcactgacggatgacgtagatatgttgcttctcgacgccggcattggaggcacc
ggaacatcgtttaattgggaaaaaatcacgccagatatagcccctaaagcgatcctggca
ggaggtcttaacctggacaatcttcccgaagccttaaagacaggatgtgccggcctggat
ctcaattctggtttcgagtactcatccaccgctgggccgtggtctgggatgaaagattcc
ggattactacggcaagcgttctccaagatccggaatttcattactagccccatttttcac
acccatcccttgcgctcatcactaaagacgtttagattattgcctatgagatatgcacta
aacatctggtggtggcgcgcttactag

DBGET integrated database retrieval system