KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1323Help
Entry
Cpha266_1323      CDS       T00439                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00220  Arginine biosynthesis
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01130  Biosynthesis of antibiotics
cph01230  Biosynthesis of amino acids
Module
cph_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Cpha266_1323
Enzymes [BR:cph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Cpha266_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ABL65354
UniProt: A1BG27
Position
1515776..1516792
Genome map
AA seq 338 aa AA seqDB search
MQHTPQQQPAKKRDFLGFRPLDAAKIIELFDFSLFIKGKRKENASEEPFLPLRQKTVAMI
FSKPSLRTRVSFELGIHELGGYSINLDGKSIGMGSRESVEDIARLLSRYNDAIVARLHDH
AVIETLAEHATIPVVNALTDLSHPCQVLADAFTLYEKKLWHDEIKIVFVGDGNNVANSWV
ELAGILPFHFVLACPEGYMPDERLLDEARAAGVSRIDITHDPKEAATDADVLYTDVWTSM
GQEDEIEERVKIFSPFQINSTLLRLAKPSAVVMHCMPAHRGQEITAEVMDGAQSIVLDEA
ENRLHVQKALLVKLLSHDVYRKFHLTHRLMNAAKNIKV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacacaccacaacaacagccggcaaaaaaacgagactttctcggattcaggcca
cttgatgccgctaaaatcatcgaacttttcgatttctcgctgtttatcaagggaaagaga
aaagagaacgcctctgaagaaccctttttgccgttacggcaaaaaaccgtagcgatgatt
ttcagcaaaccctcgcttcgaacaagagtgtcgtttgaactcggcattcacgaactcggc
ggttactcaatcaatctcgacggaaaatccatcggcatgggctcacgagagtccgtcgaa
gacattgcgaggcttctttcgcgatacaacgacgctatcgtcgcccgactgcacgaccat
gccgttatcgaaacccttgcggagcacgcaaccattccggttgtcaatgcgctcaccgat
ctctcgcacccctgtcaggtgctggccgacgcctttaccctctatgagaaaaagctctgg
catgatgaaataaaaatcgttttcgtcggcgacggcaataacgttgccaactcatgggtt
gagcttgcaggcatcctcccctttcacttcgttctcgcctgtcctgaagggtacatgccg
gatgaacggcttctcgacgaagcaagagcggcaggggtaagccggatcgacatcacccat
gacccgaaagaggccgcaactgatgccgatgtgctctataccgatgtctggacaagcatg
ggacaggaagacgaaatagaggagcgcgttaaaatattcagccccttccagatcaacagc
actctcctccggcttgccaaaccctccgctgtggtgatgcactgcatgcccgcccacaga
ggtcaggagattaccgcggaggttatggatggagcgcaatccatcgtgcttgacgaggcg
gaaaaccgcctgcacgttcaaaaagcgctgctggtaaaactgttgagccatgatgtgtac
agaaaattccatctgactcaccgcctgatgaatgcggcgaaaaacatcaaggtataa

DBGET integrated database retrieval system