KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1802Help
Entry
Cpha266_1802      CDS       T00439                                 

Definition
(GenBank) amine oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00860  Porphyrin and chlorophyll metabolism
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
Module
cph_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpha266_1802
Enzymes [BR:cph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cpha266_1802
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Cpha266_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox GIDA HI0933_like FAD_oxidored NAD_binding_9 MCRA
Motif
Other DBs
NCBI-ProteinID: ABL65819
UniProt: A1BHE2
Position
complement(2055373..2056692)
Genome map
AA seq 439 aa AA seqDB search
MMRAAVIGGGISGIASAYYLMQHNISVDLYESADRIGGRIGSERLGERWLDFGGKNIGKN
YRLFRDFVLDCGVSDFEYFGFNTSQVIGGRVVSINKEGARLFNAIRFFGLCGFSGLRKLY
PHVRAILNDRRQGVLASEYFSALAEEYDHLSLAGYLKEPCLSHIVRPVTVRMNGAEPDEC
YPGNFGSNLALLLDSYEQLQQGMHGMLEAFQLPARSALLRILPAHRVTSVNRDHGKGAVM
IGYEYEGRSLSAEYDRVVSALPALRLSELLETFCPEVSVLLRRIQYFPVAVAIVKYRQNV
FPKEQRAMVFDDSFPLSNAGAYGINDLDLVRYTFSGRAARAMVSDRSQPEAVITLGEEIA
GRYFTIKDNTRESFVFRYLSEGLCAYSPYHHRLLAEVDQKLDFFSGFAATGDYRRGASIE
ACFRAAGECVHKLLDGGKD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggcagcggttatcggcggaggaatttccggaattgcttccgcatattatctc
atgcagcacaatatcagtgttgatctttacgaatcggctgatcgtattgggggcaggatt
ggcagtgaacggcttggtgagaggtggcttgatttcggcggcaaaaatatcggaaaaaat
taccgcttgtttcgggattttgttctggattgcggtgtttctgattttgaatattttggt
tttaatacatcacaggtcattggaggccgggttgtcagcattaacaaagagggggccaga
cttttcaatgccattcgttttttcggtttatgcggttttagcggccttcgaaagctctat
ccccatgtcagggcaattctcaatgatcgtcgtcaaggggttcttgccagcgagtatttt
tctgcacttgctgaagagtatgaccatctctcccttgctggatacctgaaggagccctgt
ttaagtcatatcgtaaggccggtgacggtaaggatgaatggggctgaacctgatgagtgt
tatccggggaatttcggctctaatctcgcacttctgcttgacagttacgagcagttgcaa
cagggtatgcatggcatgcttgaagcttttcagctcccggcaagatctgctttgttgaga
attcttccggcacatcgggttacgtctgttaaccgtgatcatggcaaaggagcagtcatg
atcggttatgagtatgagggccgttctttatcagcggagtatgatcgggtagtgtccgct
ctgcctgcgcttcggttgagtgaacttcttgaaacgttttgtccggaagtttcagttctt
ttaaggcggatacagtattttcctgtagcagttgctattgtgaaatatcgtcagaatgta
tttccgaaagagcagcgcgccatggtttttgatgactcgtttccgttgagtaatgccgga
gcttatggtatcaatgatcttgatctggttcggtataccttcagcggcagggcagcaaga
gctatggtgtccgatcggtctcagcctgaagcggttattacactcggagaggagatcgcc
ggacgctatttcacgataaaggataatacgagagagtcttttgtttttcggtatctttcc
gagggactttgtgcctattcgccataccatcatcgacttcttgctgaggttgatcagaag
cttgactttttttccggttttgccgcaacgggtgattatcgtcgtggcgcatccatagag
gcgtgcttcagggcagcgggggagtgtgtgcataaattacttgacgggggtaaggattga

DBGET integrated database retrieval system