KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2387Help
Entry
Cpha266_2387      CDS       T00439                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, B subunit
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00860  Porphyrin and chlorophyll metabolism
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpha266_2387
Enzymes [BR:cph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Cpha266_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: ABL66375
UniProt: A1BIZ8
Position
complement(2774487..2776094)
Genome map
AA seq 535 aa AA seqDB search
MRLAFWLYEGTALHGISRITNSMKGVHTVYHAPQGDDYITATYTMLERTPDFPGLSISVV
RGRDLAQGVSRLPSTLQQVDHHYSPDLTVIAPSCSTALLQEDLNQLAAHSGVPSEKLLVY
ALNPFRVSENEAADGLFTELVKRYAVAQEKTPTPSVNLLGFTSLGFHLRANLTSLRRMLE
ALGIAVNVVAPWGSGIDDLAKLPAAWLNIAPYREIGATAAAYLDETCGMPAMYEAPIGVE
PTTAWLRKLLDEINRIAGQKGLSRLAMPAPRAFSLDGLSAPSGVPWFARTADMESFSNKR
AFVFGDATHTVALVKFLRDELGMQIIGAGTYLERHADWVRKELDGYLPGELMVTDRFQDV
AKFIDDQMPDLVCGTQMERHSCRKLDVPCMVICPPTHIENHLLGYYPFFGFDGADVIADR
VYLSCKLGLEKHLIDFFGDAGLEYEESDDAAKAEPDQPVSNAHGHTESKTVSQGEPIASD
EGGISWSDEAETMLKKVPFFVRKKVRKNTEDFALGIGESCVTAEVFRKAKESLGG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttagctttctggctctacgaaggaaccgcccttcatggtatcagccgaatcacc
aacagtatgaaaggggttcacaccgtctaccatgccccgcaaggtgacgattacatcacg
gccacctacaccatgcttgaacggactcctgactttccgggactctcgatcagcgtggtc
cggggaagagatcttgcgcagggagtctcaagactacccagcaccctgcaacaggttgac
catcactacagccctgacctgactgtgattgcccccagttgcagtaccgctctcctccag
gaagatctcaaccagcttgccgcccattcaggcgttccgtcggaaaaactgcttgtctac
gcgctgaaccccttcagagtgtcggaaaacgaagcggctgacggactctttacagaactc
gtcaagcggtatgctgttgcacaggaaaaaactcccactccctcggtcaacctgctcgga
tttacctcccttggctttcatttgcgcgcaaacctcaccagccttcgccgcatgctggag
gcgcttggcatagccgtcaacgtcgttgctccctggggctcaggtattgacgatcttgca
aaactgccggccgcatggctcaatattgccccttaccgggaaatcggcgctacggcagcg
gcttatcttgacgaaacctgcggtatgcctgcgatgtacgaggcccctatcggcgttgag
cccacgacagcctggctcaggaagcttcttgatgagataaacaggattgccggtcaaaaa
ggcctctcccggcttgcgatgccagcaccaagagcattttcgcttgacggcctgagtgcg
ccgagcggagtgccctggtttgcccgcactgccgacatggagagcttcagcaacaaacgg
gcatttgttttcggtgatgcaacccataccgtcgcactggtaaagtttcttcgcgacgaa
ctcggcatgcagataatcggagcaggaacctaccttgaacgtcatgccgactgggttcgc
aaagagcttgacggttaccttccgggagagcttatggttacagacagatttcaggatgtt
gcaaagtttatcgatgatcagatgcccgatctggtctgcggcacacagatggaacgccac
agttgccgcaagctcgatgttccctgcatggtgatctgcccgccgacccatattgaaaac
cacctgctcggctactaccccttcttcggttttgacggagcggatgtgattgccgacaga
gtctatctctcatgcaaactcggccttgaaaagcaccttatcgactttttcggcgacgca
ggcctcgaatacgaagagagcgatgatgccgcaaaagcagagcccgatcagcctgtcagt
aatgcccatggccatactgaaagcaagactgtttctcagggggagccgatcgcttcagat
gagggcggcataagctggagcgatgaagctgaaaccatgctgaaaaaagtgcccttcttt
gttcgtaaaaaggtaagaaaaaacacggaagactttgcgctcgggattggcgaatcatgt
gtcaccgctgaggttttccgaaaagcaaaagagtctctgggcggataa

DBGET integrated database retrieval system