KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2723Help
Entry
Cpha266_2723      CDS       T00439                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00471  D-Glutamine and D-glutamate metabolism
cph00550  Peptidoglycan biosynthesis
cph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Cpha266_2723
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cpha266_2723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cph01011]
    Cpha266_2723
Enzymes [BR:cph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Cpha266_2723
Peptidoglycan biosynthesis and degradation proteins [BR:cph01011]
 Precursor biosynthesis
  Amino acid ligase
   Cpha266_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: ABL66707
UniProt: A1BJY0
Position
complement(3113310..3114704)
Genome map
AA seq 464 aa AA seqDB search
MDVAGKKVAVLGARRSGMAVAELLSLKGASVFVSELGTIGAHESARLQALRIPFEEGGHS
DNVLCTDFCVISPGIPGRAPVVRAMLEKGIPLFSEIEVAYWFCKARIIGITGTDGKTTTA
TLVHRIFETDGMTHRYRAFSVGNIGQPFSSRVLTMRPEDVAVIELSSYQLEGCCTFRPDV
SVITNITPDHLDRYEGELHNYAQTKYRIYAHQGKEDTLVYNDDDPLLHDHFASNRETLPC
RIVPFGIGCKPEHAGFAAAVRFCDHRIVFDAGAKSENIIEAEDFLKRSFRGRHNIANALA
AVAAARALGIGNEAIRSALQGFSGVEHRQEFVRTLDGSDWINDSKATNINALSQALETVP
GRMVLIAGGRDKGSDYREIAGIVRKKVAALVAIGEAREKLCAAYGGMVDVRSANSLEEAV
SLARALVEPGQTVLFSPGCSSFDMFEDFEDRGRQFKKLTTDLRS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgcgggtaaaaaagtagccgtgcttggcgcaagacgaagcggtatggcagtt
gccgaactgctttcgcttaaaggagcctcggtctttgtaagcgagctcggtacaattgga
gcgcacgaatcagcccgtctgcaggcattgcggatcccttttgaagagggagggcattcc
gacaacgtgctttgcacggatttctgtgtgatcagtccggggattcccgggcgggccccg
gttgtcagagcgatgctcgaaaaaggcattcccctattcagcgagatcgaggttgcgtac
tggttctgcaaggcgagaattataggtattaccggcacggacggcaaaacaacgacagcg
acgctggtgcaccgtatttttgaaacggacgggatgacgcatcgataccgggcgttcagc
gtaggcaatatcggtcagccattctcatcgagagtgctcaccatgcgccccgaagacgtt
gccgttattgagctgagcagttatcagctcgaaggatgctgcaccttcaggcccgacgta
tcggtgataaccaatataaccccggatcacctcgaccggtatgaaggggagctgcataac
tacgcgcaaacaaagtatcgaatttacgcccatcagggcaaagaggacacgctggtctat
aatgatgacgacccgcttcttcacgaccattttgcctcaaacagggagaccctcccgtgc
cgcatcgttccgttcggtatcggatgcaagccggaacatgcgggttttgctgcggcggta
aggttttgcgaccacaggatcgtttttgacgccggggcaaagagcgagaacattatcgaa
gcggaagattttctgaaacggagttttcgtggccgtcacaatattgccaatgcccttgcc
gccgtcgctgccgctcgtgcgctcggtatcggcaacgaagccatccgttctgcgcttcag
ggattcagcggagtcgaacatcgtcaggaatttgtgcggacgcttgacgggagcgactgg
atcaatgactcaaaagcaaccaacatcaatgcgctttctcaggcactcgaaaccgtaccc
ggacggatggtgcttattgccggaggaagagacaaaggcagcgattacagggagatcgcc
gggattgtcagaaaaaaagtcgcggctcttgttgcaataggcgaagctcgcgaaaaactc
tgcgccgcatacggaggcatggtcgatgtcagatctgccaactcccttgaagaggcggtt
tctcttgccagagccttggttgaacccggccagacggtgctgttttcgccggggtgttct
agtttcgacatgtttgaggatttcgaggatcgggggaggcagtttaaaaaattaacgacg
gatctgcgctcatga

DBGET integrated database retrieval system