KEGG   Corynebacterium phocae: CPHO_01580Help
Entry
CPHO_01580        CDS       T05007                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cpho  Corynebacterium phocae
Pathway
cpho00061  Fatty acid biosynthesis
cpho00071  Fatty acid degradation
cpho01100  Metabolic pathways
cpho01212  Fatty acid metabolism
cpho02024  Quorum sensing
Module
cpho_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cpho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CPHO_01580
   00071 Fatty acid degradation
    CPHO_01580
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CPHO_01580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cpho01004]
    CPHO_01580
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpho04147]
    CPHO_01580
Enzymes [BR:cpho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CPHO_01580
Lipid biosynthesis proteins [BR:cpho01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CPHO_01580
Exosome [BR:cpho04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CPHO_01580
  Exosomal proteins of breast cancer cells
   CPHO_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2 FAD_binding_1
Motif
Other DBs
NCBI-ProteinID: APT93596
UniProt: A0A1L7D601
Position
complement(374372..376075)
Genome map
AA seq 567 aa AA seqDB search
MSAFENRAWLQHYAEWTPHSLDYGDTTLLDIYDNNIAINAAKPATYFFGKTQSYAELDRQ
VRRAAAGLKAFGVRPGDHVAIVAPNCPQFVAAFYAVLKLGAVAVLHNPLYTKHELEGLFQ
DHGARVAIAWDKAASTLEALRATTPLETVVSINMIDAMPVSKRLALKLPFLAAKREQLSA
DAPNTVPWETLVGNAVGGNGDDIQTPDDVTTDTTALILYTSGTTGKPKGAMLSHGNLFSN
LLMGKHWVKGLGEEPERMLAALPFFHAYGLTMNLTLAQLIGGELVLLPSPQIPLIMELMK
KHTPTWIPGVPTLYEKIVQSAEEQGVEIKGVRASFSGASTLPAASVAKWEDRTGGLLVEG
YGLTECSPIIVGNPMTAARRPGYVGIPFPDTEVRIGNPDNLDETQPDGVEGEVLARGPQI
FQGYLGNEEATREAFHGDWFRTGDMGVMEEDGFIRLVSRIKEIIITGGFNVYPGEVEEVL
REHPDVDDVAVVGRPREDGSEDVVACVNLADGAALDPDGLKEFCRERLTRYKVPRTFYNF
DELAKDQLGKIRRREVQADLMKRLEKA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttttgaaaaccgggcgtggctgcaacactacgcggagtggacgccccacagc
ctggactacggcgacaccacgttgttggacatttatgacaataacattgccatcaacgca
gctaagcctgccacctacttctttggcaaaacgcaaagctacgcggagctcgaccgccag
gttcgccgcgccgccgccggcctgaaggccttcggtgtgcgcccgggggaccacgtggcc
attgtggcccccaactgcccgcagttcgtggcggctttttacgcggttctcaagttgggg
gcggtggcggtgctacacaacccgctctataccaagcatgagctggagggcttgttccag
gaccacggggcgcgggtggctattgcgtgggacaaggcggcatcgacgctggaggctttg
cgcgccaccaccccgctggagaccgtggtgtccatcaacatgattgacgccatgcccgtg
tccaagcgcctggctttaaagttgccgtttttagccgccaagcgtgagcaactctccgcc
gatgcccccaacaccgtcccgtgggagaccctcgtgggcaatgccgtgggcggcaacggg
gatgacatccagaccccggacgatgtcaccacagacaccaccgcgctgattttgtacacc
tccgggaccaccggcaagcccaagggcgccatgttaagccacgggaatctgttttctaac
ctgctcatgggcaagcactgggtcaagggcctgggtgaggaaccggagcgcatgctagcc
gccctgccgtttttccacgcctacggcctgaccatgaacttaacgctggcgcagctcatt
ggtggggagctagtgctgctgccttccccgcaaatcccgttgattatggaattgatgaaa
aagcacacccccacctggattccgggtgtgcccacgctttatgaaaagattgtccagtca
gcagaggaacaaggcgtggaaatcaagggcgtgcgtgcgtccttctccggggcttctacc
ctgccggcggccagtgtggccaagtgggaagatcgcaccggggggctcctggtggaaggc
tacgggctcacggagtgctcgccgattattgtgggcaaccccatgactgcggcccgccgc
ccgggatacgtgggcatccccttcccggacaccgaggtccgtattggcaacccggataac
ctggatgagacccagccggacggcgtggaaggtgaggtgctcgcgcgcgggccccaaatt
ttccagggctatttgggcaatgaggaggccacgcgggaggcgttccacggggattggttc
cgcaccggggatatgggcgtgatggaagaagatggctttatccgcctggtcagccgcatt
aaggaaatcattatcactggcgggttcaacgtctacccgggtgaggtggaagaggtgctg
cgcgagcaccccgatgttgatgacgtcgcggtggttggccgcccccgcgaggacggctcc
gaggacgtggtggcctgcgtcaatcttgccgatggcgccgctttggaccccgacggcctg
aaggagttctgccgcgagcgcctcacccggtataaggtcccgcgcactttctacaacttc
gacgagctggccaaggaccagctgggcaagatccgccgccgcgaggtccaggcggatttg
atgaagcgcctggagaaggcctag

DBGET integrated database retrieval system