KEGG   Corynebacterium phocae: CPHO_02660Help
Entry
CPHO_02660        CDS       T05007                                 

Definition
(GenBank) hypothetical protein
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
cpho  Corynebacterium phocae
Pathway
cpho00040  Pentose and glucuronate interconversions
cpho00053  Ascorbate and aldarate metabolism
cpho01100  Metabolic pathways
cpho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPHO_02660
   00053 Ascorbate and aldarate metabolism
    CPHO_02660
Enzymes [BR:cpho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     CPHO_02660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: APT93620
UniProt: A0A1L7D675
Position
complement(598092..598949)
Genome map
AA seq 285 aa AA seqDB search
MDCQISLGIYEKALRSTDNWDDFFAQVNEGGFSFVDLSVDETDERRARLEWSAERRQEVR
AAAMRNGVQIGGICLSLHRLVMPGSIDPAIRAEAREVYRKGIDLCADLGISLCQIAGYYN
YYEDPHDLARKHYIDLLAEATQYAAHRGIVLGIENVDGNDINSIPAARELVDMIGSPWLQ
IYPDLGNISEHGGEETAELRAGEGHMMAIHAKDVLPGQPRRIPLGTGTVDWPAAFAELAR
QKWSGRMMLEMWNDDAPDSVETCVAARLKLTQWLEEAGFTVLNEA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggattgccaaatcagtctagggatctacgaaaaggctctgcgctccaccgataactgg
gatgatttctttgctcaggtaaacgaagggggattcagcttcgttgacctatcggtcgat
gaaaccgacgaacgcagggcccgcctagagtggtcggccgaaaggcgccaagaagtccgc
gccgccgccatgcgcaacggcgtgcaaattgggggaatctgcttgtccttgcaccgcctc
gtgatgcccgggtctatcgacccggccattcgggctgaggcccgggaggtataccgcaaa
ggtatcgacctatgcgcagacctaggaattagcttgtgccagatcgctggatactacaac
tactacgaagatccacacgatctagcccgcaaacactacattgacctccttgctgaagct
acccagtatgccgcccaccgcggcatcgtcttagggatcgaaaacgtggacggcaatgac
attaactcgatcccagccgcccgcgaactagttgacatgattggttccccctggctgcag
atctacccagatctgggaaatatttccgagcacggcggcgaagaaaccgctgagctccgc
gccggagaaggccacatgatggctatccacgcaaaggatgtactaccgggtcagccacgc
cggattccgctcgggaccggaacggttgattggccagccgcctttgctgagctagctcgg
cagaagtggagtggacggatgatgctggagatgtggaacgacgacgccccagattcagtg
gaaacctgtgtcgccgcacgcctaaaactcacccagtggctcgaagaagccgggttcacc
gtcctcaacgaagcgtaa

DBGET integrated database retrieval system