KEGG   Corynebacterium phocae: CPHO_05840Help
Entry
CPHO_05840        CDS       T05007                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cpho  Corynebacterium phocae
Pathway
cpho00030  Pentose phosphate pathway
cpho00480  Glutathione metabolism
cpho01100  Metabolic pathways
cpho01110  Biosynthesis of secondary metabolites
cpho01120  Microbial metabolism in diverse environments
cpho01130  Biosynthesis of antibiotics
cpho01200  Carbon metabolism
Module
cpho_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cpho_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cpho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CPHO_05840
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CPHO_05840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpho04147]
    CPHO_05840
Enzymes [BR:cpho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CPHO_05840
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CPHO_05840
Exosome [BR:cpho04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CPHO_05840
  Exosomal proteins of colorectal cancer cells
   CPHO_05840
  Exosomal proteins of bladder cancer cells
   CPHO_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: APT92489
UniProt: A0A1L7D2X0
Position
complement(1320214..1321746)
Genome map
AA seq 510 aa AA seqDB search
MTASQTWTNPLRDPADKRLPRIAGPSGMVIFGVTGDLAYKKLLPAIYDLANRGLLPAGFT
LVGYGRRDWSKEEFAAYVEKACAAGARTDFDANVWKHLSQGFEFVNGSFDDDGFDQLAKT
LTKLDESRGTGGNWAYYLSVPPEYFSEICHQMQRVGLAESKEDSWRRVIIEKPFGHDQKS
AQELNEIVNAVFPESSVFRIDHYLGKETVQNILALRFANQIFEPMWNAHYIDHVQITMAE
DIGLGGRAGYYDGIGAARDVIQNHLLQLLALVAMEEPSSFEPQALQAEKIKVLQATKPVH
PLNKTTARGQYTAGWQGSEYVVGLREEEGFDPDSDTETYAACTLEVNSRRWGGVPFYLRT
GKRLGRRVTEIALVFKHAPYQPFDTGQTEALGQNAVVIRVQPDEGVTMRFGSKVPGTTME
VRDVNMDFAYAEAFTEESPEAYERLILDALLDESSLFPTNEEVELSWSILDPILEFWAET
GAPQEYVSGTWGPASADKMLYRNGHEWRRP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcctcacaaacttggaccaaccccctccgggatcccgccgacaaacgcctacca
cgcattgccggaccttcgggaatggtgatctttggtgtcaccggtgacctggcctataaa
aagctcctcccggccatctacgatttggccaaccggggtctgctacccgccggatttacg
ctagtggggtacggacgccgcgattggagcaaggaagagttcgcagcctacgtagaaaag
gcttgcgcggccggcgcgcggactgattttgacgccaacgtctggaagcatctgtcgcaa
ggctttgagtttgtcaacggctcctttgacgatgacgggtttgaccaactagccaagacc
ctgacaaagctcgacgaaagccgcggtactggcggcaactgggcttactacctttcagtt
ccacccgagtatttctctgaaatatgtcaccagatgcaacgcgtgggattagctgagagc
aaagaggactcctggcgccgggtcatcattgaaaagccctttggccacgaccaaaaatct
gctcaagagctcaatgagattgtcaacgcggtctttccggaatcctcggtcttccgcatc
gaccactatttgggtaaagaaaccgtccaaaatattttggccctgcgttttgctaaccaa
atcttcgagccgatgtggaatgcccactacattgaccacgtgcagatcactatggcagaa
gatattgggctgggcgggcgcgctggttattacgacggtattggtgccgcacgcgacgtt
atccaaaaccacctgctgcagcttctagccttggtagcgatggaagaaccatcttccttc
gagccccaggcgctacaggcggaaaaaatcaaagtcttgcaggcaaccaaacctgtccac
ccattgaacaagaccaccgcgcgcggccagtacaccgccggctggcagggctcggaatac
gtggtggggctgcgcgaggaggaagggtttgaccctgattcagacacggaaacctacgcg
gcttgcaccctggaggtaaactcgcggcgctggggaggcgtgcccttctacctgcgtacc
ggcaagcggcttggccgtcgcgtcactgaaatcgccctggtattcaagcacgctccctac
cagccttttgataccggacaaacggaggccctgggccagaacgcagtggtcatccgcgtg
cagccagatgagggtgtcaccatgcgctttggttccaaggtgccggggaccacgatggaa
gtccgggacgtgaatatggacttcgcctacgcggaggcttttaccgaggaatcaccggag
gcctacgagcggctcatccttgatgccttgctcgatgagtcctccttgttccccaccaat
gaagaagtggagttgtcctggtcaatcctggatcccattttggaattctgggcggaaacc
ggggcaccgcaagaatacgtctccgggacgtgggggcccgcctctgcggacaagatgctc
taccgcaacggacacgaatggcgcaggccatag

DBGET integrated database retrieval system