KEGG   Corynebacterium phocae: CPHO_06850Help
Entry
CPHO_06850        CDS       T05007                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpho  Corynebacterium phocae
Pathway
cpho00071  Fatty acid degradation
cpho00280  Valine, leucine and isoleucine degradation
cpho00310  Lysine degradation
cpho00362  Benzoate degradation
cpho00380  Tryptophan metabolism
cpho00620  Pyruvate metabolism
cpho00630  Glyoxylate and dicarboxylate metabolism
cpho00640  Propanoate metabolism
cpho00650  Butanoate metabolism
cpho00900  Terpenoid backbone biosynthesis
cpho01100  Metabolic pathways
cpho01110  Biosynthesis of secondary metabolites
cpho01120  Microbial metabolism in diverse environments
cpho01130  Biosynthesis of antibiotics
cpho01200  Carbon metabolism
cpho01212  Fatty acid metabolism
cpho02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPHO_06850
   00630 Glyoxylate and dicarboxylate metabolism
    CPHO_06850
   00640 Propanoate metabolism
    CPHO_06850
   00650 Butanoate metabolism
    CPHO_06850
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CPHO_06850
   00072 Synthesis and degradation of ketone bodies
    CPHO_06850
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPHO_06850
   00310 Lysine degradation
    CPHO_06850
   00380 Tryptophan metabolism
    CPHO_06850
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPHO_06850
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CPHO_06850
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPHO_06850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpho04147]
    CPHO_06850
Enzymes [BR:cpho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CPHO_06850
Exosome [BR:cpho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPHO_06850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APT92659
UniProt: A0A1L7D3D1
Position
complement(1552919..1554124)
Genome map
AA seq 401 aa AA seqDB search
MDAFAKPGDRGPKGIVIVGAARTPFGKLLGGLSPIPATELGATAIRGALDNIDPGLVDAV
IMGQVLQAGVGQNPAKQAALAAGISPRAHTTTVNKICLSGLTAIIDAARLLRSGEAQVVV
AGGMESMTLSPHLLMNARAGYKFGAQTVLDHMEHDGLRAADSGISMGLLTEEYADTYPVT
RAEQDAVAARSHERALAASQDGTFDREITPVTVKTRHGEETVSRDEGIREGVTTQSLAKL
RPAFSKDGTLTAGNSSPISDGAAAVVLCSRDTAQANGWDIMATLGKPGQVAGPDSSLQEQ
PANAITRALELQGWTAKDLDMVEINEAFAAVVSHSARVLGVSEEIVNPHGGAVALGHPIG
ASGARLVVHAAHQIEAGKATRAAVGLCGGGGQGEALLLEAH
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggatgcattcgctaaaccgggggacagaggacccaaaggcatagttattgtgggagct
gcgcgtaccccattcggaaaattactgggcggactaagtccaatcccggccacggagctt
ggggcaactgccattcgcggtgcgcttgacaacattgacccgggcttggtggacgccgta
attatggggcaggtactgcaagcaggtgtggggcagaacccagccaaacaggccgcgctc
gcggcgggcattagcccccgggcgcacaccactacggtcaacaagatatgcctgtctggc
ctaacggccatcattgatgccgccaggttgctgcgctcgggtgaggcccaggtagtggtg
gctggagggatggagtccatgactttatctccacacctgctgatgaacgcgcgcgctggg
tataagtttggggcccaaacggtgttggaccacatggagcacgacggcctgcgcgcagcg
gactccggcatctcgatgggccttctgaccgaggaatatgcggatacctacccggtgacc
cgcgcggagcaggacgcggtggccgcgcgctcacatgagagggcgctggctgccagccag
gacggaacctttgaccgcgaaatcacgcccgtgaccgtcaagacgcgccacggggaagaa
actgtttctcgcgacgagggcatccgcgagggcgtgaccacgcaatccctggctaagctg
cgcccggcgtttagtaaggacgggacgctcaccgccggtaattcctcgcccatctccgac
ggcgcggctgcggtggtgctgtgcagccgggatacggcgcaggccaacggatgggacatc
atggctacgttgggcaagccagggcaggttgctggcccagattcctccctgcaagaacag
ccagccaacgccatcacacgcgcactggagctacagggctggacggccaaggacctggac
atggtggagatcaatgaggcattcgctgccgtggtgtcccactccgcgcgggtactgggc
gtcagtgaagagattgtcaatccccacggtggggcggtggcgctggggcatcccatcggt
gcctccggagcgcgactggtggttcatgcagcccaccagatagaggccggcaaggccacc
cgcgcagccgtaggcttgtgcggcggtggtgggcagggagaagccctgctgttagaagcg
cattag

DBGET integrated database retrieval system