KEGG   Corynebacterium phocae: CPHO_07845Help
Entry
CPHO_07845        CDS       T05007                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cpho  Corynebacterium phocae
Brite
KEGG Orthology (KO) [BR:cpho00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cpho03009]
    CPHO_07845
Enzymes [BR:cpho01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CPHO_07845
Ribosome biogenesis [BR:cpho03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CPHO_07845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: APT92814
UniProt: A0A1L7D3V2
Position
complement(1761112..1761984)
Genome map
AA seq 290 aa AA seqDB search
MLKDVIDLLADPNDGTALAGKDDFSRLVSESGHSFDVARQGYVTLAGGAGLKHNGDSLEM
VQARETYLSLGHFAPFVEAVTNSMIEIVDEADLSDAAQPALLEVGAGTGFYLAHTLDSID
NSRGIGLDISVHAAKHLAKCHSRAGAVVADVWDRLPVRSGSIDAISVVFAPRNPAEFQRV
LAPKGQVVVLTPQAGHLDELREPLGIVGVETGKVERMYEQAAGFLEQSAAPVELSFPMEL
DRASIAAQVGMSPSARHISQEELARRMAELPETMRVTARARLDRFRAVSK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaaggatgtaatagacctgctagctgatcccaatgacgggaccgcgctagccggt
aaggatgatttttcacgcctcgtgtcagaatcggggcattctttcgatgttgcccgtcag
gggtacgtgaccttggctggcggtgccggcctcaagcacaacggtgactctttggagatg
gttcaggcgcgtgagacgtacttgtcgctcgggcacttcgctcctttcgtggaggccgtc
accaattccatgatcgaaattgttgatgaggctgatctttctgacgctgcccaaccagcg
ttgcttgaggtgggggccggcaccggcttttacctggcgcacacgctagattcgattgat
aactcccgcggtattggcctggacatttccgtccacgccgccaagcacctggctaaatgc
catagccgggcaggtgccgttgtggcggatgtgtgggaccggttgcctgtgcgcagcggg
agcattgacgccatctcggtggtgttcgctccgcgcaacccggctgagtttcaacgggtg
ctcgcaccgaaaggccaagttgtggttcttacgccgcaggctggtcacttggatgagctc
cgtgagcctttgggaattgtgggggtagaaaccggcaaagtcgagcgcatgtacgagcaa
gctgccggcttcctggagcaaagcgccgcgccggtggagttatcattccccatggagcta
gaccgagcctccatcgccgcacaggtgggcatgagcccgtctgcccgccacatcagccag
gaagaattagccaggcggatggcggagctgccagagaccatgcgggtgaccgcacgggca
aggcttgaccgctttcgtgcggtgagcaaatag

DBGET integrated database retrieval system