KEGG   Cnuibacter physcomitrellae: B5808_04710Help
Entry
B5808_04710       CDS       T04797                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B5808_04710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cphy03011]
    B5808_04710
Ribosome [BR:cphy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B5808_04710
  Bacteria
    B5808_04710
  Archaea
    B5808_04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ARJ04600
UniProt: A0A1X9LRQ5
Position
1018175..1018570
Genome map
AA seq 131 aa AA seqDB search
MVESIARVRHIRVTPQKARRVVDLVRGRQATEALAILRFAPQAASEPVYKLVASAIANAR
VKADASNEYLDEQDLFIAKAFVDEGTTLKRFQPRAQGRAFRINKRTSHITIVLATPDEAS
VAGVSKKKASK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgcgtgcgtcacatccgcgtcacgcctcagaaggcccgtcgc
gtcgtggacctggtccgtggccgtcaggccaccgaggccctcgcgatcctgaggttcgcg
ccgcaggccgcgagcgagccggtgtacaagctggtggcctcggccatcgcgaacgcccgg
gtgaaggccgatgcgtccaacgagtacctcgacgagcaggacctcttcatcgcgaaggcg
ttcgtcgacgagggcaccacgctcaagcgcttccagccgcgtgcccagggccgcgcgttc
cggatcaacaagcgcacgagccacatcacgatcgtcctcgcgacgcccgacgaggcttcg
gtcgcgggagtctcgaagaagaaggcgagcaagtaa

DBGET integrated database retrieval system