KEGG   Cnuibacter physcomitrellae: B5808_05940Help
Entry
B5808_05940       CDS       T04797                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00450  Selenocompound metabolism
cphy00970  Aminoacyl-tRNA biosynthesis
cphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B5808_05940
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B5808_05940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cphy01007]
    B5808_05940
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cphy03016]
    B5808_05940
Enzymes [BR:cphy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B5808_05940
Amino acid related enzymes [BR:cphy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B5808_05940
Transfer RNA biogenesis [BR:cphy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B5808_05940
 Prokaryotic type
   Other AARSs
    B5808_05940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF1659
Motif
Other DBs
NCBI-ProteinID: ARJ04810
UniProt: A0A1X9LSE3
Position
1262304..1263869
Genome map
AA seq 521 aa AA seqDB search
MSDGSSFYITTPIFYVNDVPHIGHAYTEVAADVIARWHRQAGDDTWFLTGTDEHGQKILR
TATANGVTPQQWADKLVAEAWEPLLETIDISNDDFIRTTQERHEKNVQRFLQKLYDDGHI
YTGDYEGYYCVGCEEYKQLTDLVDGTGEYEGQLVCAIHSKPVELLKERNYFFRMSAFGQR
LLDLYESRPEFVQPDSVRNEIIQFVKHGLTDLSISRQTFDWGIKVPWDESHVIYVWFDAL
LNYITAVGYGEDDAEFARRWPATHIVGKDIARFHAVIWPAMLMAAGLDVPTQVYGHGWLL
VGGEKMSKSKLTGIAPEQITDTFGSDAFRYYFLRAITFGQDGSFSWEDLSARYQAELANG
FGNLASRVVAMVNRYFDGRIPEAGELIASDQRIRDTEQQVTARADAAIERLAVHEAIGAI
WQLVDELNGYITEQEPWALAKQPESALRLATVLHTAVHGVGTLAILLAPVLPKATAKLWA
ALGREDAVDAQPIRAAHEWEAVGRVTTLEALFPRIEVEAAS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgggtcctcgttctacatcacgacaccgatcttctacgtgaacgacgtgccg
cacatcggccacgcctacaccgaggtcgcggccgacgtgatcgcgcggtggcaccgtcag
gcgggcgacgacacctggttcctcaccggcaccgacgagcacggccagaagatcctgcgc
acggccacggccaacggcgtgactccgcagcagtgggccgacaagctcgtcgccgaggcg
tgggagccgctgctcgagacgatcgacatctccaacgacgacttcatccgcaccacccag
gagcggcacgagaagaacgtgcagcgcttcctgcagaagctctacgacgacggtcacatc
tacaccggagactacgagggctactactgcgtgggctgcgaggagtacaagcagctcacc
gacctcgtcgacgggacgggcgagtacgaggggcagctggtctgcgccatccactccaag
cccgtcgagctgctcaaggagcgcaactacttcttccgcatgagcgcgttcgggcagcgc
ctgctcgacctctacgagtcacggcccgagttcgtgcagcccgacagcgtgcggaacgag
atcatccagttcgtcaagcacgggctcaccgacctctccatctcgcgacagaccttcgac
tggggcatcaaggtgccgtgggacgagtcgcacgtcatctacgtctggttcgacgccctc
ctcaactacatcaccgccgtgggctacggggaggacgacgcggagttcgcgcgccgctgg
cccgccacgcacatcgtcggcaaggacatcgcgcgcttccacgcggtcatctggcccgcc
atgctgatggccgccggcctcgacgtgcccacccaggtgtacggccacggctggctcctc
gtgggcggcgagaagatgtcgaagtcgaagctcaccggcatcgcgccggagcagatcacc
gacaccttcggctccgacgcgttccggtactacttcctgcgtgccatcaccttcgggcag
gacggctcgttcagctgggaggacctctccgcgcgctaccaggccgagctcgccaacggc
ttcggcaacctcgcctcgcgggtcgtcgcgatggtcaaccgctacttcgacggccggatc
ccggaggcgggggagctcatcgcatccgaccagcgcatccgcgacacggagcagcaggtc
accgctcgcgccgatgccgccatcgagcggctcgccgtccacgaggcgatcggcgcgatc
tggcagctcgtcgacgagctcaacggctacatcaccgagcaggagccctgggcgctcgcg
aagcagcccgagagcgcgctgcgtctcgccactgtgctgcacacggcggtgcacggcgtc
ggcacgctcgccatcctgctcgcgccggtgctccccaaggcgaccgcgaagctctgggcc
gccctcgggcgggaggatgcggtcgacgctcagcccatccgcgccgcccacgagtgggag
gcggtggggcgcgtgacgacactcgaggcgctcttcccgcgcatcgaggtcgaggcggcc
tcgtga

DBGET integrated database retrieval system