KEGG   Cnuibacter physcomitrellae: B5808_10980Help
Entry
B5808_10980       CDS       T04797                                 

Definition
(GenBank) hypothetical protein
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00760  Nicotinate and nicotinamide metabolism
cphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B5808_10980
Enzymes [BR:cphy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     B5808_10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase NUDIX-like DNA_ligase_ZBD zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ARJ05686
UniProt: A0A1X9LKE8
Position
complement(2323867..2324853)
Genome map
AA seq 328 aa AA seqDB search
MSRDFQSLLPLSRQRVDRDHASRTDADVLRRLWADDASRIVVLRGGRALAAEGEAAAVAL
ITADRLPEGIGDPLADDGSTLYLGRALEGPGPIPPGSPLWAVFLPDAPAHEGTPGDRTSA
DERWLDLRLTAAELDDLGAGVFTEALAVGNWHRTHTHCPRCGAPSRAEAGGWVRRCTVQG
IELFPRTDAAVIVGVVDDRDRLLLGSNAMWENNRYSLLAGFVEPGESLEAAAIREIGEES
GVVIDDPEYVGSQPWPFPASLMVGFLARVAPGGTAAERPDGEEILDLRWFTRDELADDRH
GILFPGRSSIARAIIERWYGGPLPEAGF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgatttccagtccctcctcccgctctcgcgacagcgcgtcgatcgcgatcac
gccagccgcaccgacgcggacgtgctgcgaaggctgtgggcggacgacgcgtcgcggatc
gtcgtgctccgcggcgggcgcgccctcgccgccgaaggagaggccgccgcggtggcgctg
atcacagctgaccgtctcccggaaggcatcggcgacccgctggccgacgacggctccacg
ctctacctcggccgtgccctcgaggggccggggccgatcccgccgggctcgccgctctgg
gccgtcttcctcccggacgcgcccgcgcacgagggcacgcccggtgaccgcacctccgcc
gacgagcgctggctcgatctccgcctgaccgccgccgagctcgacgacctgggcgcgggg
gtcttcaccgaggcgctggcggtgggcaactggcaccggacgcacacgcactgcccgcgc
tgcggagcccccagccgggccgaggcgggtggctgggtgcgacgctgcacggtgcagggg
atcgagctgttcccgcgcacggacgccgccgtcatcgtcggggtcgtcgacgaccgggat
cgtctgctcctgggctcgaacgcgatgtgggagaacaaccgctactccctgctcgccggg
ttcgtcgagccgggtgagtcgctggaggccgccgcgatccgggagatcggcgaggagtcg
ggtgtggtcatcgacgaccccgagtacgtgggctctcagccgtggccgttccccgcatcg
ctgatggtgggattcctggcccgggtcgcccccggcggcaccgccgccgagaggcccgac
ggcgaggagatcctcgacctgcggtggttcacgagggacgagctcgccgacgaccggcac
gggatcctcttccccggccgctcgtcgatcgcgcgcgcgatcatcgagcggtggtacggc
ggtccgctgcccgaagcggggttctga

DBGET integrated database retrieval system