KEGG   Cnuibacter physcomitrellae: B5808_11640Help
Entry
B5808_11640       CDS       T04797                                 

Definition
(GenBank) phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00030  Pentose phosphate pathway
cphy00480  Glutathione metabolism
cphy01100  Metabolic pathways
cphy01110  Biosynthesis of secondary metabolites
cphy01120  Microbial metabolism in diverse environments
cphy01130  Biosynthesis of antibiotics
cphy01200  Carbon metabolism
Module
cphy_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cphy_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B5808_11640
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B5808_11640
Enzymes [BR:cphy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     B5808_11640
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     B5808_11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH F420_oxidored 3HCDH_N TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ARJ05803
UniProt: A0A1X9LKV3
Position
2476910..2478364
Genome map
AA seq 484 aa AA seqDB search
MTEQGKANIGVVGMAVMGSNLARNLASREGNTVAVYNRSPERTRKLVSEHPEAGFLASES
VDDFVASLSKPRTAIIMVQAGAGTDAVIAELADRFEPGDIIVDGGNANFHDTIRREKDVS
ARGIHFVGTGISGGEEGALNGPSIMPGGTAEAYETLGPILASIAAVAEGEPCVTHIGTDG
AGHFVKMVHNGIEYADMQLIAEAYDLLRTLTKREPAELAEVFETWNSGDLESYLIEITAE
VLKQVDAKTGKPFVDIVLDQAGAKGTGAWTVQNALDLGTPVGGIAEAVFARSLSSHPEQR
EAVQKTIQSRPDVVEVDVDSFADDIRAALYASKVVAYAQGFDEIIAGAKQYGWEIDKGAV
AKIWRAGCIIRAQFLNRIVEAYENDPDITSLLEDPYFAKAVAEGEAAWRRVVSTAALSGV
PIPGFSSALSYYDGLASKRLPAALIQGQRDFFGAHTYKRVDEPGVFHTLWSGDRSEIETE
PSTH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagggcaaggccaacatcggtgtggtgggaatggcggtgatgggctcgaac
ctcgcccggaacctggccagccgcgagggcaacacggtggcggtgtacaaccgctcccct
gagcgcacccgcaagctggtgtcggagcatccggaggcggggttcctcgcgtcggagtcc
gtcgacgacttcgtcgcgtcgctgtcgaagccgcgcaccgcgatcatcatggtccaggcc
ggcgcgggcacggacgcggtcatcgccgagctggccgaccgcttcgagcccggcgacatc
atcgtcgacggcgggaacgcgaacttccacgacaccatccgccgcgagaaggacgtctcg
gcccgcggcatccacttcgtcggcaccggcatctccggcggcgaggagggcgccctgaac
ggaccctcgatcatgcccggcggcaccgccgaggcctacgagaccctcggccccatcctc
gcctcgatcgcggcggtcgccgagggcgagccgtgcgtgacccacatcggcaccgacggc
gcaggccacttcgtcaagatggtgcacaacggcatcgagtacgccgacatgcagctcatc
gccgaggcctacgacctgctccgcacgctcaccaagcgcgagcccgccgagctggccgag
gtgttcgagacctggaactcgggcgacctcgagtcgtacctcatcgagatcaccgccgag
gtgctgaagcaggtcgacgcgaagaccggcaagccgttcgtcgacatcgtcctcgaccag
gccggggccaagggcaccggcgcgtggaccgtgcagaacgccctcgacctgggcaccccg
gtcggcggcatcgccgaggccgtgttcgcgcgctcactgtcgtcgcacccggagcagcgc
gaggccgtgcagaagacgatccagtcgcgccccgacgtcgtcgaggtggacgtcgactcg
ttcgccgacgacatccgcgccgcgctctacgcgtcgaaggtggtcgcctacgcgcagggc
ttcgacgagatcatcgccggagcgaagcagtacggctgggagatcgacaagggagcggtg
gcgaagatctggcgggcgggctgcatcatccgcgcccagttcctcaaccgcatcgtcgag
gcgtacgagaacgaccccgacatcacgtcgctcctcgaggacccgtacttcgccaaggcc
gtcgccgagggcgaggccgcctggcggcgcgtggtctcgaccgccgccctgtcgggtgtg
ccgatccccgggttcagctcggcgctgtcgtactacgacggcctcgcgtcgaagcgcctg
cccgccgccctcatccagggtcagcgcgacttcttcggcgcgcacacctacaagcgcgtc
gacgagcccggcgtgttccacacgctctggtcgggcgaccgctcggagatcgagaccgag
cccagcacgcactag

DBGET integrated database retrieval system