KEGG   Cnuibacter physcomitrellae: B5808_16935Help
Entry
B5808_16935       CDS       T04797                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
cphy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B5808_16935
Enzymes [BR:cphy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B5808_16935
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B5808_16935
    1.1.1.-  
     B5808_16935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 3HCDH_N ADH_N_assoc NADH_4Fe-4S AlaDh_PNT_C ADH_N_2 2-Hacid_dh_C CbiA
Motif
Other DBs
NCBI-ProteinID: ARJ06720
UniProt: A0A1X9LXE5
Position
3640630..3641763
Genome map
AA seq 377 aa AA seqDB search
MRRDMVDTTVDAIATTMSAAVYHGPRDVRLEQRAVPAPGPGEVLVRVTAAGICGTDSAEW
AHGPLLVPHDESGLVEPLVLGHEFVGTVAALGDGVELPVGSTVVCGAGISCGTCVMCRAG
RTNLCRSYHSLGLQDDGALAQYVVAPAEILYDVSDLGLSDDTLAMAQPMAVAVHAVRRSG
LHAGQDAVVVGVGGIGAFLTHVAASTGARVLALDLDPDRLDLATRLGATDTVQASDRPLV
EILAELGYEPEVFFEVSGSRRGLDSVLAAAQPGAVIVPVGLQKLPLELDLSRFTLGELTL
VGTVAHVFRNDIPEAVRLLAARAATDGWDDIASLVLPLRDLVQEGLEPLADGSSPQIKTL
VDPWIDRARPADHALTA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagacatggttgacacgacggtcgacgcgatcgcgaccaccatgtccgcggcc
gtgtaccacgggccacgggacgtgcgtctggagcagcgtgcggtgcccgcaccgggcccc
ggtgaggtgctcgtccgcgtcaccgccgccgggatctgcggcaccgactccgcggagtgg
gcccacggtcctctgctcgtgccgcacgacgagtccggactcgtcgaaccgctggtcctc
gggcatgagttcgtcgggacggtcgccgccctgggcgacggagtcgagctgccggtcggg
tcgacggtcgtctgcggagcgggcatcagctgcgggacgtgcgtcatgtgccgcgcggga
cgcaccaacctctgccggtcgtaccactcgctcggactccaggacgacggggccctcgcc
cagtacgtcgtcgccccggcggagatcctgtacgacgtctcggacctcggcctctcggac
gacaccctcgcgatggcgcagcccatggccgtcgccgtccatgcggtccgccgcagcgga
ctgcacgcgggccaggatgcggtcgtggtcggcgtgggcggcatcggcgccttcctcacc
cacgtcgccgcttccaccggggctcgggtcctcgccctcgacctcgaccccgaccggctc
gacctcgcgacgcgactgggcgccaccgacacggtgcaggcctccgaccgcccgctcgtc
gagatcctggccgaactcgggtacgagcccgaggtcttcttcgaggtcagcggcagcagg
cgcgggctggactccgtcctcgccgcggcgcagccgggcgcggtgatcgtgccggtaggg
ctccagaagctgccgctcgagctcgacctgtcccggttcacgctcggcgagctgaccctc
gtcggcacggtggcccacgtcttccgcaacgacatcccggaagcggtccggctgctcgcc
gcccgcgcggcgacggacggctgggacgacatcgcctcgctggtcctgcccctgcgggac
ctggtgcaggagggactcgagccgttggccgacggctcgtcgccgcagatcaagaccctg
gtcgatccgtggatcgaccgcgcccgccccgcagaccacgctctgaccgcctga

DBGET integrated database retrieval system