KEGG   Chitinophaga pinensis: Cpin_0180Help
Entry
Cpin_0180         CDS       T00959                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cpi  Chitinophaga pinensis
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cpin_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACU57681
UniProt: C7PC53
Position
226399..227403
Genome map
AA seq 334 aa AA seqDB search
MTLLVTIIILAFIFDYINGFHDAANSIATIVSTKVLTPFQAVLWAAVFNFAAFFISKYVY
GEFKVGNTIAKSVFEQFITLKVILCGLIAAIVWNLLTWWYGIPSSSSHTLIGGFVGAAVA
AAHGSFAVINYAKVMPIIYFIALAPFIGMAVAFVITIIIMNVCRRANPYRAENWFKRLQL
VSSGALSLAHGGNDAQKVMGIIAAALVAHGTIKDIASVPNWVPLSCFIAIGLGTMSGGWK
IVKTMGSRITKVTPLEGVAAETAGAVTLYLTESLGIPVSTTHTITGSIIGVGATKRLSAV
RWGVTVSLLWAWILTIPISALLAAVVYFIADLFI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacttgtcacgatcatcatactggcgtttattttcgactatataaacggtttt
catgatgcggctaactcaattgcgactatagtatcgacaaaagtactcacgccctttcag
gccgtactttgggcggcagttttcaactttgcagccttctttatctccaaatatgtttat
ggcgagttcaaggtaggtaacactatcgcgaaatctgtatttgagcagtttatcacactg
aaagttatcttgtgtggcctgatcgctgcgattgtgtggaacctgctgacctggtggtat
ggtataccttccagttcttcccacacactgatcggcggtttcgttggtgctgccgttgca
gctgcacacggatcttttgcggtgatcaactacgctaaagtaatgccaatcatatacttc
attgcgctggcgccatttataggtatggccgtcgcctttgtgattaccattataattatg
aacgtatgccgcagggcaaatccatacagggcggaaaactggttcaaacgtttgcagctg
gtttcctccggtgcattgagccttgcccacggtggtaacgacgcgcagaaagtaatgggt
atcatcgctgctgccctggtagcacatggtacaatcaaagatattgcctccgttcctaac
tgggtgcctttatcctgttttatcgccattggtctgggtaccatgagcggcggatggaaa
atcgttaaaaccatgggatcccgtatcaccaaggtaacaccgttagaaggtgtggctgcg
gaaactgcgggtgctgtaacgctttatctcactgaatcactgggtattcctgtaagtacc
acccacacaattaccggttctattatcggtgtaggtgctacgaaacgcctctctgcggta
cgctggggggtaactgtcagcctcctctgggcatggatacttacgatcccgatcagtgca
ctgctggctgctgtcgtttactttatagcagacctctttatctaa

DBGET integrated database retrieval system