KEGG   Chitinophaga pinensis: Cpin_0489Help
Entry
Cpin_0489         CDS       T00959                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00010  Glycolysis / Gluconeogenesis
cpi00052  Galactose metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
Module
cpi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpin_0489
   00052 Galactose metabolism
    Cpin_0489
Enzymes [BR:cpi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Cpin_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACU57987
UniProt: C7PG04
Position
complement(587217..588398)
Genome map
AA seq 393 aa AA seqDB search
MKNIFPLLTVAAAVSFSACQSGTKTDNNTADSMSTKQDSLSQGQISDAKFDTTIDGKQVK
LYHLKGKGNIQVAITNYGAKIVSLLAPDKQGQLADVELGYDNAAQYVSTKERYYGGIVGR
YGNRIAKGKFKVDGKEYTLATNNGVNHLHGGKVGFNDVVWDAEQPNDHTLKLHYVAKDGE
EGYPGNLDITLTYELTDSNEVKIDYKATTDKATVVNLTNHSFFNLHGAGNGDINDHIMYI
NADKFTPVDSTLIPTGKLQAVKGTPMDFTTPTKIGERVDADFEQLKFGKGYDHNYVLNKK
GKELSLAATVEEPTSGRTLEVWTTEPGVQFYGGNFLDGTDKGKEGKSYVHRGAFCLETQH
FPDSPNKPTFPSVVLKPGETYTSTCVYKFGVKS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatatttccactattaacagtggcggccgcagttagcttcagcgcctgccag
tctggtacaaaaaccgataataatacagcagatagtatgagtaccaagcaagacagtctt
tctcagggccagatatcagatgcgaaatttgatactaccatcgacggcaaacaggtgaaa
ttatatcacctgaaaggtaaaggaaatatccaggtagctattaccaactatggcgcaaag
atcgtaagtctgctcgctcctgataaacagggacaactggccgacgttgagctgggttat
gataatgccgctcagtatgtaagcaccaaggaaagatattatggtggtatcgtaggccgt
tatggcaaccgtatcgctaaaggtaagttcaaagtggatggtaaagagtataccctcgct
accaacaatggcgtgaatcacctgcacggtggtaaagtaggttttaatgatgtggtatgg
gatgctgagcagccaaatgatcacaccctgaaactgcactatgtagcaaaagacggtgaa
gaaggataccctggtaacctggatatcacactgacttacgaactgacagacagcaacgaa
gtaaagatcgattataaagccactaccgataaagcaactgtggtaaacctgactaaccac
tctttcttcaacctgcatggcgcgggtaatggcgatatcaatgatcatatcatgtatatc
aatgccgataagttcacaccggtggacagtaccctgatccctaccggtaaactccaggcg
gtaaaaggtacaccgatggacttcaccacacctaccaaaatcggtgaaagagtagatgct
gatttcgaacagctgaaattcggtaaaggatacgatcacaactatgtgctgaacaaaaaa
ggtaaagaactgtcactggcagctactgtagaagagcctaccagcggccgtaccctggaa
gtatggacgactgagccgggtgttcagttctacggtggtaacttcctggatggtaccgac
aagggtaaagaaggtaaaagctatgtacaccgtggtgcattctgcctggaaacacagcac
ttccctgattcaccaaataagcctacgttcccttcagtagtactgaaaccgggagaaacc
tatacttctacctgtgtgtataagtttggcgtaaaatcttaa

DBGET integrated database retrieval system