KEGG   Chitinophaga pinensis: Cpin_1481Help
Entry
Cpin_1481         CDS       T00959                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00030  Pentose phosphate pathway
cpi00480  Glutathione metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
cpi01200  Carbon metabolism
Module
cpi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cpi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cpin_1481
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cpin_1481
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpi04147]
    Cpin_1481
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Cpin_1481
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Cpin_1481
Exosome [BR:cpi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cpin_1481
  Exosomal proteins of colorectal cancer cells
   Cpin_1481
  Exosomal proteins of bladder cancer cells
   Cpin_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N EIAV_Rev
Motif
Other DBs
NCBI-ProteinID: ACU58978
UniProt: C7PST9
Position
1815519..1817024
Genome map
AA seq 501 aa AA seqDB search
MQNHKRPPASIIFIFGGSGDLNYRKLSPALYNLFLDNYMPEKFAIAGIGRSPYDNSAYRE
RLLDGVQKFSRRKGEQNGHWNDFSQHVTYLQMDAEDRASYSAITDYVKAKEEEWGEHPNV
IFYLSVAPQLMPAIAQKLGSLNLCSDKHSTRIVVEKPFGHDLQSAHELNELLLSMFSEEQ
IYRIDHYLGKETVQNLIALRFANALFEPLWNRNYIDHIQITASETVGLEGRGGYYENSGA
LRDMVQNHILQVMCMIAMEAPVSFDANEIRNKKVDVLNAIRKFTKDKIHENAVRGQYSAG
WRQGKQMPGYREEKGVDPESATETYAAVKFFIDNWRWQGVPFYVRTGKNMHQKATNITLQ
FRQAPHYAFPAESAETWRPNRLTISIQPEMDIRIRFQAKRPGQSMELDPVEMVFNFDRQY
GDDHAPEAYETLLLDVMEGDATLFMRADQVEAAWKVVMPILETWESRTPVDFPNYAPDSW
GPEDADAMIARDGHAWINLPK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatcataaacgtccgcctgcttccatcatcttcatcttcggcggcagcggcgac
ctgaattacagaaaactttcgccggctttatacaacctgttcctcgataattacatgccg
gaaaaatttgcaattgccggtattggccgtagtccatatgacaatagcgcttatagggaa
cgtttactggatggtgttcagaagttctcccgccgtaaaggtgagcagaatggccattgg
aacgacttcagtcagcatgttacctatctgcagatggatgcggaagaccgcgcttcttac
agcgcgatcactgattatgtgaaggcaaaagaagaagaatggggtgaacatcctaacgtg
atcttctacctctcagttgctccgcagctgatgcctgctatcgctcagaaactgggttcc
ctgaacctgtgcagcgataaacacagtacccgtatcgtggtagaaaaaccattcggtcat
gacctgcaaagtgcgcatgaactgaatgaactgctgctcagcatgttctctgaagaacag
atctaccgtattgaccactacctcggtaaagaaaccgtacagaacctcatcgcgctgcgt
tttgccaatgcgctgtttgagcctttatggaatcgtaactatatagatcacatacagatc
accgcttctgaaaccgtaggcctggaaggtcgtggcggttactatgagaactcaggtgca
ctgcgcgatatggtgcagaaccacatcctgcaggtaatgtgtatgatcgctatggaagcg
cctgtatcattcgatgcaaacgaaatccgtaacaagaaagtagatgtacttaacgcgatc
cgtaagttcacaaaggataagatccatgagaacgctgtacgtggtcagtattctgctggc
tggagacaaggtaaacagatgcctggttatcgtgaagagaaaggtgtagatcctgaatca
gcaactgaaacttacgcagcggttaaattctttatcgacaactggcgctggcagggtgta
ccgttctacgtacgtaccggtaaaaacatgcaccagaaagcgaccaatattaccctgcag
ttccgtcaggcgccgcactacgcgttccctgctgaatcagcagaaacatggcgtccaaac
cgcctgaccatcagcatccagccagaaatggatatccgtatccgcttccaggcaaaacga
ccgggtcagagcatggaactggatccggtggaaatggtattcaacttcgatcgtcagtat
ggtgacgaccatgcgcctgaagcatacgaaacactgctgctggacgtaatggaaggagat
gcgaccttgttcatgcgcgctgaccaggtagaagctgcctggaaagtggtaatgccgatc
ctggaaacatgggaatcccgcacaccggttgactttcctaactacgctcctgattcctgg
gggcctgaagatgcagacgccatgatcgcaagagatggacatgcctggatcaatctacct
aaataa

DBGET integrated database retrieval system