KEGG   Chitinophaga pinensis: Cpin_2305
Entry
Cpin_2305         CDS       T00959                                 

Definition
(GenBank) hypothetical protein
Organism
cpi  Chitinophaga pinensis
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACU59796
UniProt: C7PG64
Position
complement(2840091..2841923)
AA seq 610 aa
MPREQKERIKDRMLKTAARLWGYPDAEVESSFDPIVQLLLEACSSELEKISGEVDVSHAR
LVERLAQIMMPEPITSSQPAYGVLHAGSNEPSTVIDAEHQLFYTSKSGFNSKDLFFMPLT
RHRLFRGQVKYMAIGNRLFETRDHWFKEQILQGNLQADTPPNHLWIGLSLEGSPSSIEEM
SFFFDLRNVHQQEMFYYYLPLARFYLNDTELTIKSGYSQSQDAAAEDVDNIMHPAFDTNT
RYSQQILHRFRHQFLTISKHTSLPLQSPAPETLQHIFGAAFNKIQPNTHWIRIEFPETIR
HTLLEDLFCNINCFPVVNKRVNEQSQRLNRYLNIMPLHTADIYFDVKRVHDTSGTDYHVR
NFTTAGEMQEGELVVRSSGIGRFDTREAKEIIAYLIEVIRDESSLFEEVRNDYVANRIRE
LHQLIASLEEQLQPSVNRGNIPYLMVKPREEADFLFIEFFTTNGSVANNIRMGTRLQEYG
SVQLQPGSITLLSNTQGGKDRLSIDEKVNLYRYHLLSRDRVVTPEDIKALCRYVVGNELR
NVSVAKGVSVLPGATEGYTRTLDIRLTLSQPTTAYAAVNLVYLKDELLSQLKERSANNYP
YRIYMNEVLM
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgccaagagaacaaaaagaaaggataaaagaccggatgctcaaaacggccgcccgactc
tggggatatccggatgcagaagtggaatcttcttttgatcccattgtacaactcctgctg
gaagcctgttccagtgaacttgaaaaaatatcaggcgaagtagatgtgtctcatgcaaga
ctggtagaaagactggcgcagatcatgatgccggaacccatcaccagcagtcagcctgct
tacggtgtattacatgccggcagtaatgaaccatctaccgtgatagatgcagaacaccag
ctgttctatacttcaaaaagcggcttcaattcaaaagaccttttcttcatgcccctgacc
aggcatcgcctgttccgcggacaggtcaaatatatggccatcggcaaccgtctttttgaa
acgcgtgatcactggtttaaagaacagattctgcagggtaatctgcaggctgataccccg
cccaatcatttatggataggtctgtccctggaaggcagtccttcctcaattgaagaaatg
tcctttttctttgacctcagaaacgttcatcagcaggagatgttttactactatctccca
ctggcgcgcttctatctcaatgatacggaactgaccataaaaagtggctatagccagagc
caggacgccgctgctgaagatgttgataatatcatgcatcctgcctttgataccaacacc
cgttacagccagcagatcctgcaccgtttccgccatcagtttctgaccatcagtaaacac
acctcgcttccgctgcaatcacctgcaccggaaacgttgcaacatatattcggagccgca
ttcaataaaatccagcccaatacacactggatcagaattgaattccctgaaactatccgg
catacattactggaagatcttttctgcaacatcaattgcttccctgtcgtcaataaacgc
gtcaatgaacagtcacagcgcctgaaccgttatctcaacatcatgccgctgcatactgct
gatatctactttgatgttaaacgtgtacatgataccagcggaaccgactatcatgtacgt
aacttcacgacagccggagaaatgcaggaaggcgaactggttgtgcgtagcagcggtatc
ggcagatttgatacccgcgaggcaaaagaaatcatcgcctacctcattgaagtgatccgt
gatgaaagttcgctttttgaagaagtacgtaacgactatgtcgccaaccgcatccgtgaa
ttacatcagctgattgcctccctggaagaacaattacaacccagcgtcaatcgtggtaac
attccatacctaatggtgaaaccacgcgaggaggctgatttcctgtttatagagttcttt
accacaaatggtagtgtagcgaataatatccgtatgggcacgcgtttgcaggagtatggc
agcgtacagttacaaccgggttctatcacgcttctttccaatacacagggtggtaaagac
cgtctcagcatcgacgaaaaagtaaacctttaccgttatcacctgcttagccgggaccgt
gtagtaacaccggaagatatcaaagcgctctgccgttatgtggttggtaatgaactacgc
aatgtaagtgttgccaaaggtgtttctgtattacccggcgctacggaaggatataccaga
acactggatatcaggttaacattatcgcaacctacaactgcttatgcggcggtgaacctc
gtgtatctcaaagatgaattattatcacagctgaaggagcgttcagccaacaattatcct
tacagaatctatatgaatgaggtgttgatgtga

DBGET integrated database retrieval system