KEGG   Chitinophaga pinensis: Cpin_2308
Entry
Cpin_2308         CDS       T00959                                 

Definition
(GenBank) hypothetical protein
Organism
cpi  Chitinophaga pinensis
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ACU59799
UniProt: C7PG67
Position
2843606..2844559
AA seq 317 aa
MVNNAQKAAVLEEVIDHIRRLHYDVRAEVVVGELLDNDVQESEVAVQMQNVFTRAFNKDI
LDAQLDDSQPYHPFITLTLSRDGLYDRLPEGLFHEFTAQKQQEVSEMVANYKKHQQEEQE
ARKFFRPLEHEFFLQRVFLEQREKHLLFDALGKDADELFLSFWGIPDGLPKEPVNKLIRL
LPYIHRIAGNLPLVQLYLQAILDEPVAITCENGPVAVSSGIQTGLGECRLGVDTMTGSLF
YTDMPRVIVKVGPLQHRRVYDFLSWQPYGKLLETCLGFLLPADVEAETLLEPHPDEKQVV
VNDSRHKEGLMGYNFFL
NT seq 954 nt   +upstreamnt  +downstreamnt
atggtaaataatgcccaaaaagccgcagtgctcgaagaagtgatcgatcacatacgtcgt
ctccattatgacgtacgcgcagaagttgttgtgggagaactgctggacaatgatgtgcag
gagtcggaagtagccgtacagatgcagaacgtttttacaagagctttcaataaagatatc
ttagatgcacaattagatgattcacagccatatcatcctttcattactttaacactctcc
cgtgacggcctgtatgaccggttaccggaaggcctttttcacgagtttacggcccagaaa
cagcaggaagtcagcgaaatggtagctaactacaaaaagcaccagcaagaggaacaggag
gcccgtaaattcttccgtccgctggagcatgaatttttcctgcaacgtgtatttttagag
cagagagagaagcacctgttatttgatgcactgggaaaggatgcagatgaattattttta
tctttctggggcattccggatggattacccaaagaaccggtgaataaacttatcaggtta
ttaccgtatattcatcgtatagcaggcaacctgcctttggtgcagttatacctgcaggcg
atactggacgaaccagtagccattacatgtgaaaacggacctgttgccgtatcctcaggt
atacaaaccggcctcggagaatgcaggctgggggtggatacgatgacaggaagtcttttt
tataccgatatgcctagagtcattgtgaaagtaggtcctctgcaacatcgccgggtatac
gatttcctgtcctggcaaccgtatggtaaattactggaaacctgcctgggctttcttttg
ccggcggatgttgaagccgaaactttactggagccacatccggatgaaaaacaagtagtt
gtaaacgatagccgccataaggaaggattaatgggatataattttttcctatag

DBGET integrated database retrieval system