KEGG   Chitinophaga pinensis: Cpin_2310
Entry
Cpin_2310         CDS       T00959                                 

Definition
(GenBank) hypothetical protein
Organism
cpi  Chitinophaga pinensis
SSDB
Motif
Pfam: T6SS_VasE SUN
Other DBs
NCBI-ProteinID: ACU59801
UniProt: C7PG69
Position
2845542..2846717
AA seq 391 aa
MAEPLKYFPVNWVDGMKIKKQHFIETENAMLDQIRDAISSGLHAQNYGLLPAKAESKESL
RCWFVTDNQHQWRVKLTECRAVTPGGARIEIPEHTVHSLKYATTFPEISYWWDPQHTEAA
YYILIQVDPFDRQPSGEPLLHEDPPRLPNATPEYELFIQPASQMPQGQLGAYQMILGRIT
VKDGRPQLDDDYIPPTSLVSAHPALADLHQELDQFLGYLELHGVQIVQKIYGKNQNNDLA
QVVLYITERMVQYLGTRISQFRWLGLYQSPAEMLEVVAGLSRTMKNAIDLRAHTGKEELL
NYLSEWCELRQGELETLMVNCSNIRYKHTDVRECLEPMIPFVRAISKLFESLSRLDYIGS
KTDKGIFVKEESAEDSEYLRKHKTKRWFFTD
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcagaaccgctcaaatattttcccgtcaactgggtggatggaatgaaaattaagaag
cagcatttcattgaaactgaaaatgcaatgcttgatcagatccgggatgctatatccagc
ggtttgcatgcgcagaactatggactattgccggctaaagcagagagtaaggaatccctt
cgctgctggttcgtaacagataatcagcatcagtggcgcgtcaaacttacagagtgccgt
gcagtaacgcctggaggagcacgcatcgagatcccggaacataccgtacattctttgaag
tatgcaactacatttcctgaaatatcttactggtgggatccgcagcatacagaagctgct
tactacattctgatacaggtggatccatttgaccgtcagccaagtggtgaaccgctgttg
cacgaagatccgccacgtttgccaaatgctacgccggaatatgagttgttcatacaacct
gcatcacagatgccacagggccagttaggcgcctatcagatgatactgggacgtattacc
gtgaaggatggacgtccgcagctggatgatgattatatcccacctaccagtcttgtatca
gcgcatcctgcactggcggatctgcatcaggaactggaccagttcctcggttacctggaa
ttgcatggtgtacagatcgtgcagaaaatctatggtaaaaaccagaacaatgatctggcg
caggtggtattgtacatcacggaaagaatggtgcaatacctcggtacgcgtatctcacag
ttccgctggttaggattgtatcagtcgcccgcagagatgctggaagtagtagcaggattg
tccagaaccatgaaaaacgccatcgacttacgagcgcatacaggtaaggaagaactgctg
aattatctttcagaatggtgtgaactgagacagggagaactggaaacactgatggtgaac
tgttcgaatatacgttataagcatacagatgtaagagaatgtctggagcctatgatacct
ttcgtacgtgcgatcagtaaactgtttgaaagtctcagcagactggattacatcggcagc
aaaacggacaagggcatctttgtcaaggaagaatctgcggaagattctgaatacctgcgc
aagcataaaaccaaaagatggtttttcacagattga

DBGET integrated database retrieval system