KEGG   Chitinophaga pinensis: Cpin_2331Help
Entry
Cpin_2331         CDS       T00959                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00020  Citrate cycle (TCA cycle)
cpi00310  Lysine degradation
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
cpi01200  Carbon metabolism
Module
cpi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpin_2331
  Amino acid metabolism
   00310 Lysine degradation
    Cpin_2331
Enzymes [BR:cpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cpin_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ACU59822
UniProt: C7PG90
Position
2872789..2874219
Genome map
AA seq 476 aa AA seqDB search
MAIVELVMPKMGESIMEATILRWHKKPGDQVKADETVLEIATDKVDSEVPSIADGEITEI
LYAENDVVPVGTVIARINTTADAGFATAAPVAPPAAQSAPVAASEEVHVVTNEPASAPYE
AQFVTSGARFYSPLVLTIAQQEGISFAELEKIPGTGNEGRVTKKDILNFVEAKSKGHVPA
AAPVQQQETAAPVEQPVSRPAATTPVAAVPTTAPASNNGVAAPPTTQQPTSAPISMGSYT
GNVEIIEMDRMRKLIAEHMVRSKHTSPHVTSFAEADVTNMVKWRDQIKKEFEKREGEKIT
FTPLFIEALVRCIKKYPLLNSSLEGDKIILKRDINVGMATALPSGNLIVPVIRNADMLNL
VGLTRQVNHLANAARQNKLKPDDTQNGTITLTNVGSFGSLAGTPIINQPQVAILAVGAIK
KRPVVIETPHGDTIAIRHMMYLSMSYDHRIVDGALGSTFLSAVAHELEHFNPEREY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggccattgtagaactggtaatgcccaaaatgggggaaagtattatggaagccaccata
ttacgttggcataagaagccgggagatcaggtaaaagctgatgaaaccgtgcttgaaatt
gcaacggataaggtggatagcgaagtaccttctattgccgatggggagattaccgagata
ctctacgcagaaaatgacgtcgtaccggtaggtactgtcatagcacgtatcaatactact
gctgatgccggctttgcaactgcagctccggtagcgccaccggctgcacagtccgcgcct
gttgccgcaagtgaagaagtacatgttgtaacaaatgaacctgcaagcgctccttatgaa
gcacagtttgtgacgagcggcgcccgtttctattctccactggtgctgacaattgcacaa
caggaaggcatcagtttcgccgaattggaaaaaataccaggtaccggcaatgaaggtcgt
gttaccaagaaagatatcttaaacttcgtagaagctaagagcaaagggcatgttcctgct
gctgcacctgttcaacaacaggaaactgcggctccggtagaacagcctgtaagccgtccg
gctgctacgacgcctgttgctgctgttccgacaacagcgccggccagcaacaatggagtg
gctgctccgccgactacacaacagccgaccagcgcacctataagtatgggtagctacact
ggtaatgtggaaatcattgaaatggatcgtatgcgtaagctgatcgcagagcatatggtg
cgtagtaaacataccagtccgcatgtaaccagctttgcagaagcagacgttaccaacatg
gtgaaatggcgtgatcagattaagaaagagttcgaaaaaagagaaggagagaagatcact
tttacaccactctttatcgaggcactggtaagatgtatcaagaaatatcctttgctgaac
agctctctggagggtgataagatcattctgaaaagagatatcaatgtcggtatggctaca
gcgttaccatctggtaacctgatcgttccggtgatccgcaatgcagacatgctgaacctg
gtagggttgacccgtcaggtaaatcatctcgcgaatgctgcccgtcagaacaagctgaaa
cctgatgatacgcaaaacggtaccatcaccctgactaacgttggttcttttggtagtctg
gcaggtacgccgattatcaaccagccacaggtagccatcctggcggtgggagctattaag
aagcgtcctgtggtgattgaaacaccacatggcgataccatcgctatccgtcacatgatg
tatctgtcaatgtcttacgatcaccgtatcgtggatggcgcattgggatctactttcctg
agtgctgtagcacatgaactggaacatttcaatcctgaaagagagtattaa

DBGET integrated database retrieval system