KEGG   Chitinophaga pinensis: Cpin_4460Help
Entry
Cpin_4460         CDS       T00959                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
cpi  Chitinophaga pinensis
Brite
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Cpin_4460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrom_C550 Auto_anti-p27 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACU61902
UniProt: C7PI30
Position
5551872..5552909
Genome map
AA seq 345 aa AA seqDB search
MHRLQLILITGFSLLLLACSKSDDILAFIGFKKPAHFPAPVYKLENNPVTQEGFELGRKL
FYESRLSRNNTVSCGFCHLQTAAFTHHGHDVSHGIDDRLGSRNSPPIMNLAWNTTFMWDG
GVFDLDLQPIVPITNPVEMDETVENVLNKLRNTAPYPAMFKKAFGTEEITTARMMKALSQ
FMVMLVSDQSKYDSVIRKQGPVFTQEEQQGYTLFQQKCSSCHKEPLFTDQSFRNNGIGTG
PNNDEGRYSVSLNAADKYRFKVPSLRNLAYTAPYMHDGRMYTLNAVLHHYTSEVQDMATL
DPLLKQNGVPGIPLSANEQQYLLAFLNTLNDRHFITDKRFSEESQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgattacaattaatactgatcacgggattttcacttttactactcgcctgtagt
aaaagtgatgatatcctggctttcatcggatttaaaaagccggcgcattttcctgcgcct
gtatacaagctggaaaacaatccggttacgcaggaaggttttgaattgggcaggaagctc
ttttatgagtcacggctttcccggaacaatacagtttcctgtgggttctgtcatttgcag
acagcggcatttacccatcatggacatgatgtgagtcatgggatagacgaccgcttaggt
agccgtaactcccctcccattatgaatctcgcctggaacacgacgtttatgtgggatggc
ggtgtatttgatcttgacctgcaacctatcgtaccgattacaaatccggtagaaatggat
gaaacggtagagaatgtgctgaataagttacggaatacggcgccttatccggcaatgttt
aaaaaagcgtttggtacagaagagatcaccacggccaggatgatgaaggccttgtcacag
tttatggtaatgcttgtcagcgatcagtctaaatacgacagcgtcatccgaaaacagggg
cctgtgtttacacaggaagagcaacaagggtatacgctgtttcagcagaagtgcagtagt
tgtcataaggagcccttattcacggatcagtcgttccggaacaatggtattggtactggg
ccgaacaatgatgaagggcgttattctgtgtcgctgaatgcagcagacaagtacaggttt
aaagtcccgagcctgcggaacctggcttatacagccccttacatgcatgacgggcggatg
tacacgttaaatgcggtcctgcatcattatacctcggaggtacaggacatggctacgctg
gatcctttgctgaaacaaaacggcgtgccggggattcctttatctgcaaatgaacagcaa
tacttattagcgtttctcaatacgctcaatgaccggcattttattacagacaagcgtttc
tcggaggagtcgcagtaa

DBGET integrated database retrieval system