KEGG   Chitinophaga pinensis: Cpin_4870
Entry
Cpin_4870         CDS       T00959                                 

Definition
(GenBank) GPW/gp25 family protein
Organism
cpi  Chitinophaga pinensis
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACU62304
UniProt: C7PN94
Position
complement(6091335..6091769)
AA seq 144 aa
MSDLLYQKPFRLRNIFAGKELDITDTGRSISQHIELIIFTRYGEHRHNEDYGCEIWDLDF
ELVVSERIWEEKFRQSLQRSIMRDEPRLDRIEVEVKMSEVEKLFFGRNISEIKKKVALTV
TGIVQSTGEHYSFNTALFLSPLCS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtcagacttactatatcagaaaccttttcgtctcaggaacattttcgcaggaaaggaa
cttgacatcaccgataccggccgctctatttcacagcatattgaactgatcatctttacc
agatacggagagcatcgtcataatgaagactatggttgtgagatctgggacctggatttt
gaactggtagtcagtgaaaggatatgggaagagaagtttcgtcagtccctgcaacgttct
attatgcgggatgaaccaagactggatcgcatagaggtagaggtgaaaatgagtgaagta
gagaaactgtttttcggcaggaatatctctgagataaagaagaaagtagcgcttaccgtt
accggtatcgtgcagtcaacaggcgagcattacagttttaatacggcgctgtttttaagt
ccgctatgcagttag

DBGET integrated database retrieval system