KEGG   Chitinophaga pinensis: Cpin_6386Help
Entry
Cpin_6386         CDS       T00959                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00430  Taurine and hypotaurine metabolism
cpi00620  Pyruvate metabolism
cpi00640  Propanoate metabolism
cpi00680  Methane metabolism
cpi01100  Metabolic pathways
cpi01120  Microbial metabolism in diverse environments
cpi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cpin_6386
   00640 Propanoate metabolism
    Cpin_6386
  09102 Energy metabolism
   00680 Methane metabolism
    Cpin_6386
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Cpin_6386
Enzymes [BR:cpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Cpin_6386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ACU63790
UniProt: C7PJN0
Position
8026565..8027749
Genome map
AA seq 394 aa AA seqDB search
MDKKNTVILTINCGSSSLKFALFDYSSLALISKGNIQNIGAESSIHIEDAAGHEERAMQA
VPDLETAIQLLTGLLEDSYAPYTIHAIGHRIVQGGKEHYLPELITPALLDAFESLIPLAQ
GHLPAEITAIRAFASAYPAVPQIACFDTAFHKDMPFTAKYFAIPRHLWEDGIIRYGFHGL
SYEYIYQQLQQSSPQEARGKIIIAHLGNGASMAAIRDGKSIDTTMGLTPTGGLVMSTRSG
DLDPGVILYLLKEKQFLSERALNELLNKQSGLKGVSGTVADIQTLLEKENTDPKAAEAVQ
LFCYQAKKYIGALTAATEGIDTLIFTGGIGLHAPLIRERICAGLGYLGIQTDAALNNDNR
DIISPEGAPVKVRVMATNEELIIAQHTQQCLHTH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaaaataccgtcatcttaaccattaactgcggctcttccagtctgaaattt
gccttgtttgattacagttccctagcactgatcagcaaaggaaatatacagaacatcggt
gctgagagcagcattcatattgaagacgccgccggtcatgaagaacgggctatgcaagcg
gtgcctgatctggaaacagcgatacaattactcaccggactgctggaagacagttacgca
ccttatacgatccatgcgatcgggcaccggattgtacagggcggcaaagaacattactta
cccgagttaattacccccgccctcctggatgcattcgaatcactgataccactcgcgcag
ggccaccttccggctgaaatcaccgccatacgcgcctttgcatccgcctatccggcggtg
ccgcagatagcctgttttgataccgcctttcacaaagacatgcccttcacagcaaaatat
tttgccattccccgtcacctgtgggaggatggtattatcagatacggttttcatggcctt
tcgtatgagtacatttatcaacaactacagcaatcgtcaccacaggaagccaggggaaaa
atcatcatcgcgcatctgggcaacggagccagcatggccgctatacgcgatggtaaaagt
atagataccactatgggcctgacgcccaccggcggcctcgtcatgagtacccgctctggt
gacctcgatcccggtgtcatactctacttactaaaagaaaaacaattcctcagcgagagg
gctttaaatgagctgctcaacaaacaatcaggtctaaaaggcgtatccggcaccgtagct
gatatccagaccctgctggaaaaagaaaacaccgatcccaaagcagcagaggcagtacaa
ctgttctgttatcaggcgaaaaaatacatcggtgctttaacagcagctacagaaggtata
gacacattgatatttaccggtggcatcggtttacacgccccgctgataagagaaaggatc
tgtgccggtctcggatacctgggtatacaaacagatgcggcactgaataatgataaccgt
gacatcatctctccggaaggcgctccggtgaaagtcagggtaatggctacaaatgaagag
ctcattattgcacaacacacacagcaatgtttgcacacacattaa

DBGET integrated database retrieval system