KEGG   Chitinophaga pinensis: Cpin_6562Help
Entry
Cpin_6562         CDS       T00959                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00010  Glycolysis / Gluconeogenesis
cpi00052  Galactose metabolism
cpi00500  Starch and sucrose metabolism
cpi00520  Amino sugar and nucleotide sugar metabolism
cpi00521  Streptomycin biosynthesis
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
cpi01200  Carbon metabolism
Module
cpi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpin_6562
   00052 Galactose metabolism
    Cpin_6562
   00500 Starch and sucrose metabolism
    Cpin_6562
   00520 Amino sugar and nucleotide sugar metabolism
    Cpin_6562
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cpin_6562
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cpin_6562
Enzymes [BR:cpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cpin_6562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N BcrAD_BadFG FGGY_N DEDD_Tnp_IS110 Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ACU63966
UniProt: C7PM61
Position
8230431..8231396
Genome map
AA seq 321 aa AA seqDB search
MSQQLAVGIDIGGTNTKFGIVDRRGNILCDGRMLTNQHEDVHGFLDELHEHLSVLIAQVG
GIENIRGIGVGAPNGNFYTGNIEYAPNLRWKGIIPLAKLLGEKFGVPAILTNDANAAALG
EFQYGAARSMRDFIVITLGTGVGSGIVANGQLIYGHDGFAGELGHCIVIPGGRYHPGTGA
HGSLEAYASATGVTNTALEFLANRPDTQSILRDHSKEEINSKVIYEAAMKGDPLAVEVYE
FTGKILGEALANFVMFSSPEAIILFGGLTKAGDMIMKPVREHMEKNLLPIFQNKVKLVFS
ELKESDAAILGASALAWEMKD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaattagcggtgggcattgatattggaggaaccaatacaaagtttggcata
gtagatcgcagaggtaatattctgtgtgatggtcgtatgctaacgaaccaacacgaagac
gttcatggcttcctggatgagttgcacgagcatctctccgtattgatcgcacaggtaggt
ggcattgaaaacatcagaggtatcggtgtaggtgcaccaaatggtaacttttataccggt
aacattgaatatgctccaaacctccgctggaaaggtattatacctttagcaaaattgctg
ggtgaaaagtttggcgtaccggctatccttaccaatgacgctaacgcagcggcactcggt
gaattccagtacggtgctgcaagaagcatgagagatttcatcgttatcacgctgggtaca
ggggtaggtagcggtattgttgccaacggtcagctgatctatggtcacgatggcttcgca
ggtgaactcggtcactgtatcgtgatccctggtggcagataccatcctggtacaggcgca
cacggttccctggaagcatatgcttctgcaaccggtgtaaccaacactgccctggaattc
ctggctaaccgcccggatacacagagcatcctgcgtgatcattcgaaagaagagatcaat
tccaaagtgatatatgaagccgcaatgaaaggcgatccgctggcagtagaagtatacgaa
ttcaccggtaaaatactcggtgaggccctggccaactttgtcatgttctccagccctgaa
gcgatcatcctgttcggtggtctgaccaaagcaggcgacatgatcatgaaacctgtacgc
gagcatatggagaaaaacctcttgcctatcttccagaacaaagtgaagctggtcttctcc
gaactgaaagaaagcgatgcggctatcctcggtgcaagcgccctggcatgggaaatgaaa
gattaa

DBGET integrated database retrieval system