KEGG   Chitinophaga pinensis: Cpin_7085Help
Entry
Cpin_7085         CDS       T00959                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00010  Glycolysis / Gluconeogenesis
cpi00020  Citrate cycle (TCA cycle)
cpi00620  Pyruvate metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01120  Microbial metabolism in diverse environments
cpi01130  Biosynthesis of antibiotics
cpi01200  Carbon metabolism
Module
cpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpin_7085
   00020 Citrate cycle (TCA cycle)
    Cpin_7085
   00620 Pyruvate metabolism
    Cpin_7085
Enzymes [BR:cpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cpin_7085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACU64486
UniProt: C7PSN7
Position
8866381..8868021
Genome map
AA seq 546 aa AA seqDB search
MAEVIRMPLLSDTMTEGVIAEWHKKVGDTVKADDVIAEVETDKATMEVMGYVEGTLLYIG
VEKGKAAKVNEIIAIVGKPGEDYKSLLGGGNNNGQAAPEAKPAAQEASAPAPAASTADSA
AVAEALKNATVIRMPLLSDTMTEGKIVAWNKKVGDTVKSDDVLAEVETDKATMEVIGYAD
GELLYVGVKEGDAAKVNGIIAIVGKKGTNVDVILAAEGTGGAKPAAQAAPAATPAASAAP
AATPEVSENKDGGRVKASPLAKKLAEEKGIDINKVTGSGDGGRIVKKDVDSFVPSAAPAA
AAKPGAAPAAKAAAFAPAGQEGHTDIQLSQMRKVIAKRLSESKFSAPHFYLKVDINMDKA
IEARKAINEVSPVKISFNDMVIKASALALRQHPDVNSSWMGDFIRQNHHVHIGSAVAIED
GLIVPVIRFADQKSLSQIAADAKELYDKAKNKKLQPQDFSGNTFTISNLGMMGIDEFTAI
INPPDSAILAVGGIKETVVSEKGQFKAVNIMKLTLSCDHRSVDGAVGARFLATLKSYLEN
PVTMLV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatcagaatgccccttttgagtgacactatgactgaaggggtgatcgcg
gaatggcataaaaaggtaggtgataccgtaaaagcagacgacgtaattgctgaggtggaa
acagataaagccaccatggaagtaatgggttatgtggaaggtactctattatatattggt
gtcgagaaaggtaaggctgctaaagtaaatgagattatagctattgtagggaaaccaggt
gaagactacaagtctttgctgggtggaggaaataataatggccaggccgcacctgaggct
aagccagcagctcaggaagcttccgctccggctcctgccgcaagcaccgcagacagcgca
gctgttgctgaagcactgaaaaacgccactgttatccgtatgccgctgttaagcgatacc
atgacagaaggtaaaatcgtagcctggaacaagaaagtgggcgacaccgtaaaaagcgat
gacgtattagcagaagtggaaactgataaagcgaccatggaagtaatcggttatgcggat
ggtgaactcctttatgtaggcgtaaaagaaggtgatgctgctaaagtaaacggcatcatt
gcaatagtaggtaaaaaaggtaccaatgttgacgttatcctggctgcagaaggcacaggt
ggcgctaaaccggccgctcaggcagcaccagcagctactccggctgcatctgcagctcct
gcagctactcctgaagtttctgaaaataaagatggtggtcgtgtaaaagcatctccgctg
gctaagaaactggctgaagaaaaaggtatcgatatcaataaagtaactggttccggcgac
ggtggcaggatcgtgaagaaagacgtagatagctttgttccatctgctgctccggctgca
gccgcgaaaccaggtgctgctcctgctgcgaaagctgcggcatttgcaccagcaggtcag
gaaggtcatacagacatccagctgagccagatgcgtaaagtgatcgctaagcgtctgagc
gaaagcaaattctccgctcctcacttctacctgaaagtagatattaacatggataaagcg
attgaagcgcgtaaagctatcaacgaagtatctcctgttaagatctccttcaacgatatg
gtgatcaaggcttctgccctggcattgcgtcagcatcctgatgtaaacagcagctggatg
ggtgatttcatccgccagaaccaccacgtacacatcggttctgctgtggctatcgaagat
ggtctgatcgttcctgtaattcgttttgctgatcagaaatcgctgagccagatcgcggct
gatgcgaaagagctgtacgacaaagcgaaaaacaaaaaactgcaaccacaggatttctct
ggtaataccttcactatctccaatctgggtatgatgggtatcgacgagttcactgctatc
atcaaccctccggattccgcaatcctggctgtaggtggtatcaaagaaaccgttgtttct
gagaaaggacagttcaaagctgtaaacatcatgaaactaaccctgagctgtgaccaccgt
agtgtggacggagcagtaggcgcacgtttcctggctacgctgaagagctacctggaaaat
ccggttacaatgctggtatag

DBGET integrated database retrieval system