KEGG   Chrysemys picta (western painted turtle): 101930844Help
Entry
101930844         CDS       T04662                                 

Gene name
SLC4A1
Definition
(RefSeq) solute carrier family 4 member 1 (Diego blood group)
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpic02000]
    101930844 (SLC4A1)
   04147 Exosome [BR:cpic04147]
    101930844 (SLC4A1)
   04090 CD molecules [BR:cpic04090]
    101930844 (SLC4A1)
Transporters [BR:cpic02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   101930844 (SLC4A1)
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101930844 (SLC4A1)
CD molecules [BR:cpic04090]
 Proteins
  101930844 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 101930844
NCBI-ProteinID: XP_005302015
Position
Un
AA seq 928 aa AA seqDB search
MEDPGQEDYEAEMKSRLDEEGYGDPELKQSNMSLDEQGSSSSLDQIQKASGSAEAAHPAT
SSRGTHEAYVELQELVMDTNNELRWMEAGHWIKLEEDFEEAGHWGRPHLSYLTFRSLLEV
RKAFTKGTVLLDLPEKFLAGITNQLIDQMIYEGQLKPQDREVFLRTLLLQHSHPDGSESM
GTLSPGQMERKDTKDEVTSQPLMQEYHQIEMQTLTDTEQEGPRGHAFSKQLLEKIPEDAE
ATLVFVGRAAFLDHPTLAFVRLREAVELDLVLAVPVPVRFLFMVLGPDSPHISYHEIGRA
VSTMMAERGFRRDAYLAEERQDLIKGVEEFLDCSIVLPPCEIQNEQLLRSLVPMQKELLR
KRYLPDEKKPEMKILKDLDQGLADKALEEEDDDPLRRTGRPFGGLVRDIKRRYPKYLSDI
KDALNAQCLAAVIFIYFAALSPAITFGGLLGEKTSNLIGVSELLISTAAQGIIFCLLGAQ
PLLVVGFSGPLLVFEEAFFKFCESYGMEYIVGRVWIGFWLILLVLVVVAFEGSFLVRYIS
RYTQEIFSILISLIFIYETFAKLITIFQKHPLRKDYVSATDPKPNTALLSLVLMAGTFFI
AFFLRKFKNSAFLPGKLRRVIGDFGVPIAIFIMALADFFIKDTTFTQKLSVPEGLKVSNT
TARGWFIHPLGKNRDFPIWMMFGAALPALLVFILIFLESQITTLIVSKPERKLVKGSGFH
LDLLLIVGMGGIGALFGMPWLSATTVRTITHANALTVMGKTTTTGEKAQVQEVKEQRISG
LLVAILVGLSILMEPILKLIPLAVLFGIFLYMGVTSLNGIQLYDRILLLLMPPKYHPDEP
YVKRVKTWRMHIFTLTQILCLAALWAVKSTPASLALPFLLILTVPLRRFLLPRIFKDIEL
KCLDADDADVSFDETEGRDVYHEVQMPI
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atggaggatccgggccaggaggattatgaagctgagatgaagagcaggctggatgaagag
ggctacggggaccccgaactgaagcaatcgaacatgtccctcgatgaacaaggcagttcc
tcctcgttggatcagatccagaaggcgtcagggagcgcagaggctgcccacccagccacc
tccagccgggggacacatgaggcatatgtggagttacaagaactggtcatggatacaaac
aacgagctgcgctggatggaggccggccactggatcaagctggaggaggactttgaggag
gcggggcactgggggaggccgcacctctcatacctgacattccgcagcctgctggaggtg
cgcaaggccttcacgaaaggcactgtcctactggatctgcctgagaagttcctggcaggc
atcaccaatcagctgatagaccaaatgatctacgaagggcagctcaaaccacaggacaga
gaggtgttcctgagaaccctgctgctacagcacagccacccagatgggtctgaatccatg
gggaccctttccccaggccaaatggaacgaaaggacaccaaggacgaggtcacgtcccag
cctctcatgcaggaatatcaccagatcgagatgcagacgctcacggacacggaacaggaa
gggccccgggggcacgccttcagtaagcagctcctcgagaagatcccagaggatgccgag
gccacgctggtcttcgtaggccgcgctgccttcctggatcaccccaccttggccttcgtg
cgcctgagggaagcggtggagctggacttggtcctggcggtgcccgtccccgtgaggttc
ctcttcatggtgctgggacctgactccccgcacatcagttaccacgagatcggacgggcc
gtctccaccatgatggcagaaagggggttccgtagggacgcctacctggcagaggagcgc
caggacctgataaagggcgtggaggagtttctggattgcagcattgtcctcccgccctgc
gagatccagaacgagcagctactccggagcctggtgcccatgcagaaggagctgctgcgg
aagcggtacctgccggacgagaagaagccggaaatgaagatcttaaaggacttggatcaa
ggcctggcagacaaggccctcgaggaggaggacgacgacccactgcggcggaccggccgg
ccgttcgggggcctggtgcgggacattaagcgccgctaccccaaatacctcagcgacatc
aaggacgccctcaatgcccagtgcctggccgctgtcatcttcatttatttcgcagccctc
tcccccgccatcacctttgggggcctactgggggaaaaaacaagcaacctgataggggtc
tcggagctgctgatctccacagccgcgcagggcatcatcttctgcctcctcggcgctcag
cccctgctggtggttggcttttcgggtcccctgctggtctttgaagaagccttttttaag
ttctgtgagagctacggcatggagtacatcgtgggccgggtctggattggcttctggctc
atcctcctggtgctggtggtggtggccttcgagggcagcttcctggtgcgctacatctcc
cgctacacccaggagatcttctccatcctcatctccctcatcttcatctacgagaccttc
gccaagctcatcacgatcttccagaagcaccccctgcggaaggattacgtgtcggccacg
gacccgaaacccaacacagccctgctctccctggtcctcatggccggcaccttcttcatc
gccttcttcctgcgcaagttcaagaacagcgccttcctgcccggcaagctccggcgtgtg
attggtgactttggggtccccattgccatcttcatcatggcgctggccgacttcttcatc
aaggacaccacattcacccagaaacttagcgtccctgaaggcctcaaggtctccaacacg
actgcccggggatggttcatccatccactggggaaaaacagagacttcccaatctggatg
atgtttggtgctgcccttcctgccctcttggtctttatcctcattttcctggagtcgcag
atcacaacgctgattgtgagcaagcccgagaggaagctggtgaagggctcgggcttccat
ctggacctgctgctgattgttggcatgggaggcatcggcgcgctctttggcatgccctgg
ctcagtgccaccacggtgaggacaatcacgcacgccaacgccctgacggtgatgggcaag
accaccaccaccggggagaaggcccaagtccaggaggtcaaggagcagaggattagtggg
ctcttggtggccatccttgtaggtctctcgatcctcatggagcccatcctgaagctgatc
ccgctggctgtgctcttcgggatcttcctctacatgggggtcacctccttgaacgggatc
caactctacgaccgcattctcctcctgctgatgccacccaagtaccaccccgacgagccc
tacgtcaagcgggtgaagacctggcggatgcacatcttcacgctcacccagatcctgtgc
ctggccgcgctgtgggcggtgaagtccaccccggcctccttggcgttgcctttcctcctc
atcctgacggtgcccctgcgccgcttcctgctccccaggatcttcaaggacatcgaactc
aagtgtctggacgcagacgatgccgacgtgagcttcgatgagacagaaggccgtgatgtg
taccatgaagtgcagatgccgatttga

DBGET integrated database retrieval system