KEGG   Chrysemys picta (western painted turtle): 101931780Help
Entry
101931780         CDS       T04662                                 

Definition
(RefSeq) stromelysin-1-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cpic01002]
    101931780
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     101931780
Peptidases [BR:cpic01002]
 Metallo Peptidases
  Family M10
   101931780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin DUF4953 Reprolysin_3 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 101931780
NCBI-ProteinID: XP_005300432
Position
Un
AA seq 483 aa AA seqDB search
MKNLPFLLLLWAASCAFPIDPKRKVEEETKLVQKYLENYYSFKTDGKPVLRWKSDSPIVN
KIKEMQEFIGLEVTGKLDSNTLEVMQKPRCGVPDVADFSTFAGQPKWGKRTLTYRILNYT
PDMAQVDVDAAIKKAFTVWSNVIPLTFTRVDRGDADILISFAARVHNDFNPFDGPGGTVA
HAYAPGNGIGGDAHFDEDEDWTKGSQGANLFFVAAHEFGHSLGLFHSRHPDSLMYPVYRH
FDAKTFRLHQDDINGIQYLYGPSSNPPEDPTESTVSIEPLEPTEPLPPNTCDPNLTFDAV
TTFRGEIMFFKDKYFWRKHPTSREVDFNLISSFWSPLPSGLDAAYEITDKDETFLFKGNE
FWVVRGDAILSGYPKKIHDLGFSKGVKKIDAALHNAIKKKTYYFVSNKYWSYDERRQSMD
KKPKLIKDEFPGINGKIDAVFQHKSKWKLSGFIYFFRGSRQFEFDPITKKVTRVLKTNFW
FPC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccttccgtttctgctgttactatgggccgcatcttgtgcttttcctatagat
ccgaaaaggaaagtggaagaagagacgaagcttgttcagaagtacctggaaaattactac
agctttaagacagatgggaagcctgttttaagatggaaaagcgatagtcccatagtcaac
aaaatcaaagaaatgcaggaattcatcggattggaggtgactgggaaattggattctaac
actctggaggtgatgcagaaaccccggtgtggagtccctgatgttgctgatttctccacc
tttgcaggacaaccaaaatgggggaaaagaactctaacatacaggattttgaactacaca
ccagacatggcccaagttgatgtagatgcagccatcaagaaagcttttacagtctggagc
aatgtgatcccattgacatttacccgggttgacagaggtgatgcagatatattgatctcc
tttgcagccagagttcacaacgatttcaatccctttgatggtcctggtgggacggttgct
catgcctatgcacctggcaatggtattggtggagatgctcactttgatgaggatgaagac
tggaccaaaggctcacagggtgccaacttgtttttcgtggctgcgcatgagtttggccat
tcactgggactcttccattctagacaccctgattcactgatgtacccagtttatagacac
tttgatgccaagactttccgtcttcatcaggatgatattaatggcattcaatacctctat
ggaccttcatctaacccccctgaagatccaacagaatctactgtctccatagaacccctg
gagccaacagaaccgctaccaccaaacacttgtgaccctaatctgactttcgatgctgtc
accactttccgtggagaaataatgttctttaaagacaagtacttctggcgcaaacaccct
acaagcagagaagttgactttaatttaatatcttcattctggtcacctctgccatctggc
ttggatgctgcctatgaaattacggacaaagatgagacatttctttttaaaggaaatgaa
ttctgggttgtcagaggagatgctatactgtctggatacccaaagaaaatccatgatttg
ggcttctcaaagggtgtgaagaaaattgatgcagctcttcataatgcaattaaaaaaaaa
acatactactttgtgtctaacaagtactggagttatgatgaaagaagacagtccatggac
aagaagccaaagctgataaaagatgaatttccaggaattaatgggaagattgatgctgtt
ttccagcataaaagtaagtggaaactctcagggttcatatatttctttcgtggatcacgg
cagtttgagtttgatccaattaccaagaaagttactcgtgtcctaaagactaacttctgg
tttccatgctaa

DBGET integrated database retrieval system