KEGG   Chrysemys picta (western painted turtle): 101931917Help
Entry
101931917         CDS       T04662                                 

Gene name
ADRA1A
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04020  Calcium signaling pathway
cpic04080  Neuroactive ligand-receptor interaction
cpic04261  Adrenergic signaling in cardiomyocytes
cpic04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101931917 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101931917 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101931917 (ADRA1A)
   04270 Vascular smooth muscle contraction
    101931917 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cpic04030]
    101931917 (ADRA1A)
G protein-coupled receptors [BR:cpic04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    101931917 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 101931917
NCBI-ProteinID: XP_005285240
Position
Un
AA seq 467 aa AA seqDB search
MVFLPLNSSDCSNCTQTVGIVNNFKAILLGVILGGLIIFGVLGNILVILSVACHRHLQSV
THYYIINLAVADFLLTSTVLPFSAIFEILGYWVFGRIFCNIWAAVDVLCCTASIMSLCII
SIDRYIGVSYPLRYPAIVTEKRGLLALLSVWALSLVISIGPLFGWKEPAPEDETICQITE
EPGYVLFSAFGSFYLPLTIILVMYCRVYVVAKRESKGLTSGLKTEKSHSEEVTLRIHRKN
TSVRSRSASCTKNKTHFSVRLLKFSREKKAAKTLGIVVGCFILCWLPFFIVMPIGVFFPA
LKPSDTVFKITFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCFTRKQAANKHSLSFN
LNQPASPSMDGAKDVVRIPVGSGETFYRISKSNGVCEWKIFSTMQSMSTKSAISKDKSSC
ARAKVKSKGFLRTCCCTGTSRSVARENLKVPTIKIHTISLGENGEDV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggttttcctccctttaaattcctctgactgttcaaattgcacccagactgtggggata
gtgaacaattttaaggccatattattaggggttattttaggggggctgattatttttggg
gtgctgggtaatattctggttatcctctcagtagcctgccacagacaccttcagagtgtc
acccattactacataatcaacctggctgttgcggacttcctcttaacttccactgtcctg
cctttctcagcaatctttgagattttgggctactgggtctttgggaggatcttctgcaac
atctgggcagctgtcgatgtcctatgctgcacggcatccatcatgagcctatgtatcatc
tctatagacagatacattggggtgagctacccactgagatatccagctatagtgacagaa
aagaggggactcctggctctgctaagtgtctgggctttgtctctggtgatctccattgga
ccgctctttggctggaaggagccagctccagaagatgagaccatctgtcaaatcactgaa
gagcctggctacgtattgttctctgcttttggctccttctacctccccttgaccatcatc
ttggtgatgtactgtagagtgtatgtggtggccaaaagggaaagcaaaggcctgacttct
ggcttgaaaacggagaaatctcattctgaagaggtgaccctccggatccatcgcaaaaac
acctcggtacggagcagatctgcatcctgcacaaagaacaaaacgcacttctcagtgcgt
ctcctgaagttctccagggaaaagaaagcagccaagaccctggggatagtggtggggtgc
ttcatactgtgctggcttcctttctttatagtcatgcctattggcgttttctttcctgca
ctcaagccctcagacacggtttttaaaataacgttttggcttgggtatttgaacagctgc
atcaacccgatcatctacccgtgctcgagtcaagagtttaaaaaagcattccaaaatgtc
ctacgagcccagtgtttcaccagaaagcaagcagccaacaagcattcccttagcttcaat
ctgaaccagccagctagccccagtatggacggtgccaaggatgttgtccgtatccctgta
ggatcgggggaaaccttctataggatttccaagtccaatggggtctgcgagtggaagatt
ttctccaccatgcaaagcatgtctacaaaaagtgcaatctctaaagacaagtccagctgc
gccagagccaaagtgaagagcaaaggtttcctcaggacatgctgctgtactggcacatca
aggagcgtcgctcgggagaaccttaaagtgccaaccattaaaatacacactatctccctc
ggtgaaaacggggaggatgtctaa

DBGET integrated database retrieval system