KEGG   Chrysemys picta (western painted turtle): 101932598Help
Entry
101932598         CDS       T04662                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00010  Glycolysis / Gluconeogenesis
cpic00562  Inositol phosphate metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101932598 (MINPP1)
   00562 Inositol phosphate metabolism
    101932598 (MINPP1)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101932598 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101932598 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 101932598
NCBI-ProteinID: XP_005292546
Position
Un
AA seq 471 aa AA seqDB search
MASCFRGPLPGRPSLPLFLLLLRVSLAQERAAATSLLSGYFGTKSRYEEVNQHLLQDPLS
LGPPDPGYLLPSAACAPLQLRALIRHGTRFPTEKQIRKLGQLHRLLRSQERPCPAAQQFA
HWDMWYHPDMDGKLAPKGRLDMEQLAQRLAARFPGLFSPQRRFAFASSSKHRCVESSAAF
RKGLQLALHRQLPARDIENEETEINDKLMRFFDHCEKFVTCVEENATAMYEVDAFKQGPE
MKRVLEKIAATLCVPVRDLNADLVQVAFFTCSFELAIKNVNSPWCSLFNEEDAKVLEYLN
DLKQYWKRGYGYDINSRSSCILFQDIFKHLDKAIAESKSSMPISSPVILQFGHAETLQPL
LALMGFFKDEEPLAANNYKKQMHRKFRSGRIVPYASNLIFVLYHCDQAKTPEEEYQVQIL
LNEKLLPFPHSEETVSLYTDLKNHYKDILQNCHFSEECELSKTNNTSTDEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctgcttccgcggccccctcccggggcgcccctcgctgccgctgttcctgctg
ctgctccgcgtctccctcgcgcaggagagggcggcggccacgtccctgctgagcggctat
ttcgggaccaagtcccggtacgaggaggtgaatcagcacctgctgcaggacccgctctcc
ctggggcccccggacccggggtacctgctgccctccgccgcctgcgccccgctgcagctc
cgcgccctcatccgccacggcacacgcttccccaccgagaagcagatccgcaagctgggc
cagctgcaccgcctgctccgcagccaggagcggccctgccccgccgcgcagcagttcgcc
cactgggacatgtggtaccacccagacatggacgggaagctggcgcccaagggccgcctc
gacatggagcagctggcccagcgtctggccgcccgcttccccggcctgttctccccgcag
cgccgcttcgccttcgccagcagctccaagcaccggtgcgtggagagcagcgccgccttc
cgcaaggggctgcagctggccctgcaccggcagctcccggccagagatatcgagaatgaa
gagactgagattaatgacaaattaatgaggttttttgatcattgtgagaagtttgtaacc
tgtgtagaagagaacgctacagctatgtacgaagtggatgccttcaaacagggtcctgag
atgaaaagggttttggaaaaaattgcggctaccttgtgtgtaccagtgcgtgatttaaat
gcagatttggtccaagttgctttttttacttgttcgttcgagttagctattaaaaatgtg
aattctccttggtgctcactcttcaatgaagaggatgctaaggtactggaatacctgaat
gacctaaagcagtactggaagagaggatatgggtatgatatcaacagtcgttccagctgt
attttatttcaagatatcttcaaacacttggacaaagccattgcagagagtaaaagttcc
atgcccatttcttcacctgtaatcctgcaatttggacatgcagagacccttcagccactg
cttgctctaatgggtttcttcaaggatgaggagccccttgctgctaacaattacaaaaaa
caaatgcatcggaagtttcgtagtggtcgcattgtgccttatgcctcaaacctgatattt
gtgctttatcactgtgaccaagctaagacccctgaggaggagtaccaagtacagatactg
ttgaatgaaaagctgctgccatttcctcactcggaggaaactgtctctctgtacacagat
ctgaagaaccattataaggacatccttcaaaactgccacttcagtgaagaatgtgaatta
tcaaaaactaataatacttccactgatgaactttga

DBGET integrated database retrieval system