KEGG   Chrysemys picta (western painted turtle): 101932721Help
Entry
101932721         CDS       T04662                                 

Gene name
PARP9
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 9
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101932721 (PARP9)
Enzymes [BR:cpic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101932721 (PARP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP PuR_N
Motif
Other DBs
NCBI-GeneID: 101932721
NCBI-ProteinID: XP_005279896
Position
Un
AA seq 839 aa AA seqDB search
MKDWKKGEKAWKKDGMMGPPRQGSQHGQRKEEEFLLGSQGKALDWNKVSSMDTEEESLTI
PISKDVYEILTRRESCLRDLIEKKFGCISVLKSIRCPLEVYRKTLKEGIEISVWMDDMTR
HNADALVNAANEYLHHIGGLALALAKAGGLEIKQESKRYIERHGKLTTGQIAVTGGGRLS
CKKIIHTVGPRWSAYESERCCQTLEAAIINVLKYVNDPDNKIKSLAIPAVSSGIFGFPLD
LCADVIVKTIKNFVELAPLFGWIKEIHLVNIDEPTVAAMKRACEKLLGRSDINSLQETLP
ASANQLQDSITINGLHLHIIRGQIEDQQTAIIVNSVVINDDLSRGNISRAILQKAGSFLQ
QEFRFESQKLPQSCEKFILTKGYNLACKSVLHIVWSSQSSSDSRKVLKTAMSRCLLKIQE
PPFPSISFPVIGSGVLHLPKDEVADIMIDEVLSFAKEHPGRKLDVYFVIHPNNSFVYKAF
RTKFDSAKSKLGQDVECNRSDDLGSRSDRPAEMENKKTGLAIELIGNRCETLEAAKIWIK
NIMQVQESHRIVIENNHIFNLSKKDHAELSRLQRFGASISEEVVGGKARLEIQGPPGAVI
DAVFLIENLLCDVQENNRAKQEELLLSEGHLDYPPERLRDKTRDTKMRYQISPVESYCQE
FKDREKRFEKAGLRVLKIEKIHNPVLSAAFQRIKKCVEGKTIGKQICHRLYQRVPAQFCS
LVCRAGFQRTYSPPPEQKYGAGIYFIRNPRNLMEDTKEKCEMDHLICVFEAEVVTGLYTE
GKQSYIVPPAVDADGMTVYDSVVDDVHKPETFVIFNSNQAVPHYILTCSQIWAEGSVPY
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattggaagaaaggtgagaaggcctggaagaaggatgggatgatgggaccaccc
agacagggaagtcagcatggacagaggaaggaagaagagttccttctgggaagtcaggga
aaggcacttgattggaacaaagtgtccagcatggatacagaggaggaaagcttaacaatt
cccatcagtaaagatgtttatgaaatccttacaagacgagagagctgtctacgtgacctc
attgagaagaagtttggttgtatatctgttcttaagagtataagatgtcctcttgaagta
tacaggaaaaccctgaaggaaggaattgagatatctgtttggatggatgatatgacaaga
cataatgctgatgctttggtgaatgcagccaatgaatatttgcaccatattggaggcctt
gctcttgccctggcgaaagctggtgggctagaaattaaacaagagagtaaacgttatatt
gagcgtcatggaaaactcaccactggtcaaatagcggtaacaggtggaggcaggctttct
tgtaagaaaattatccacacagtaggtccaaggtggtctgcatatgaaagtgagagatgt
tgtcaaacacttgaggcagccattataaatgtcctgaaatatgttaatgatccagataat
aaaataaagtctctggctatccctgcagtgagctcaggaatttttggcttcccactagat
ttatgtgctgatgtgattgtaaagactataaagaattttgttgagctagctccattattt
ggctggatcaaagaaatccacttggtgaacattgatgagcccacagttgcagcaatgaaa
agggcctgtgaaaagttgctggggaggagtgacatcaactcacttcaggagactctgcca
gcttcagcaaaccagcttcaagattccatcacaatcaatggtcttcacctacatatcata
agaggacaaattgaagatcagcaaactgcaattattgttaattctgtggtcataaatgat
gatctgtcaagaggaaacatttcaagagcaattctgcaaaaagcaggctcatttcttcag
caggaatttcggtttgagtctcaaaaacttcctcaatcttgtgagaaattcatattgaca
aaaggatacaatctggcctgcaagtctgtgctccacatagtatggtcatcacaaagcagc
agtgattcacgcaaggtactaaaaactgcaatgtcaagatgtttgcttaagattcaggag
cctccatttccttcaatttccttcccagtaattggatctggagtattacatttgccaaag
gatgaagtggcagatattatgattgatgaagttttaagctttgcaaaggaacatcctggg
aggaagttagatgtgtattttgtgatccatccaaataacagttttgtctacaaggctttc
cgaaccaagtttgattcagcgaaaagcaaactgggacaagatgtggaatgcaacagaagt
gatgatttggggtcacgctctgacagaccagctgaaatggagaataaaaaaactggacta
gccattgaacttattggaaaccgctgtgaaacactggaagcagcaaaaatatggatcaaa
aacataatgcaagtccaggaaagtcaccgtatcgttatcgaaaacaatcacatttttaac
cttagcaaaaaagatcatgcagaactgtctcgtctgcaacgtttcggtgcatccatatca
gaagaagtggttggtggaaaggcgagattagagattcaaggtcctcctggtgctgtaatt
gatgcggtgttcttgatcgaaaatttactgtgtgatgtgcaagagaataatagagccaag
caagaggaactgctgctgtcagagggccatctggattatcctccagaaagactccgagac
aagacaagggataccaaaatgcgttaccagatctctccagtagaatcatactgccaggaa
ttcaaggaccgagaaaaacgatttgaaaaagctgggcttcgtgttctcaagatagaaaaa
atacataatcctgttttatcagctgccttccaacggattaaaaaatgtgtagaaggaaaa
actattggaaagcagatatgccatagattgtaccagcgtgttcctgctcagttctgtagc
ttggtatgcagagctggatttcagagaacatactcccctccaccagaacaaaaatatgga
gctggcatctactttatcaggaaccccagaaacctaatggaggataccaaggaaaagtgt
gaaatggaccatctaatttgtgtatttgaggctgaggtagtaacaggcttatacactgag
ggcaaacagtcttatattgtgccaccagcagttgatgcagatggcatgactgtatatgac
agtgtagtagatgatgttcacaagcctgaaacctttgtcatttttaacagtaatcaggcc
gttccacactatatattgacatgttcccagatttgggctgaggggtcagtgccttactag

DBGET integrated database retrieval system