KEGG   Chrysemys picta (western painted turtle): 101932840Help
Entry
101932840         CDS       T04662                                 

Gene name
CDKL2
Definition
(RefSeq) cyclin dependent kinase like 2
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101932840 (CDKL2)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101932840 (CDKL2)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   101932840 (CDKL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase RIO1 Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 101932840
NCBI-ProteinID: XP_005284040
Position
Un
AA seq 593 aa AA seqDB search
MECAWLYHSSPSPVLVLLSLSAAQRHSCFGVKMEKYETLGLVGEGSYGMVMKCRNKDSGR
IVAIKKFLESEDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTLL
DDLELFPHGLDYNRVRKYLFQIIKGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFA
RTLAAPGEAYTDYVATRWYRAPELLVGDTKYGKAVDVWAIGCLVTEMLTGEPLFPGDSDI
DQLYHIMKCLGNLTPRHQELFYKNPLFAGVRLPEVKEAEPLERRYPKLSAAVLDLAKKCL
QIDPDKRPSCAELLQCDFFNKDGFAERFAQELRLKIQKDARDHPLPKKSKISKKDKDDSL
GEERKMLDIQDFNIDPKIKDSKLFKVKLSKAEVEKADRSSNMSCLYDSGTSQFKTVPPTS
MKDSSSSLDYIKNPGMVIPPIIPNLATITPNISVNSGMGTIPGTHNYRVDEKTKKYLTPF
IKQGKHSPAGHYNVSLGTSVSNEKNVLQANKKRWEFSKTDVRLPELNYNHLPELKGVDAR
NSRFVKKENKTVSESRIPSLASIDLHNPSLALQQISGTSLPDASEASFPRVER
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcgcttggctgtatcacagctccccctcgccagtgttagttcttctcagtctt
tctgcagcacaaagacacagctgtttcggagttaaaatggaaaagtatgagacccttggg
ctagtcggagagggaagctacggaatggtaatgaagtgtagaaataaagacagtggaaga
atagtcgccatcaagaagtttttggaaagtgaggatgataaaatggttaaaaaaattgcc
atgcgagaaatcaagctactcaagcaacttcgacatgaaaatctggtgaacctgctggaa
gtgtgtaagaagaagaaacgatggtatctggtgtttgaatttgtggatcacacactcctc
gacgaccttgagctgtttccacatggactagattacaatagagttcggaaatatttattt
cagattataaaaggaataggattttgtcacagtcacaatataatacacagagacattaaa
ccggaaaatatattggtctcccaatcaggagttgtaaaactctgtgattttggattcgct
cgtactctggcagcccctggtgaagcttacactgactatgtggcaacgcgatggtacaga
gctccagaactgttggttggcgataccaagtatggcaaggcagtggatgtgtgggccatt
ggctgtctggtcacggaaatgcttacaggagagcccctgtttcctggggactcggacatt
gaccagctgtaccatatcatgaaatgtctgggcaacttaactccacgccatcaagagctg
ttctataaaaatccactctttgctggagtgaggttgccagaggtcaaggaggccgaacct
cttgaaagacggtatcccaagctctctgcggcagtgttggatttagccaagaaatgcttg
cagatcgatccggacaaaaggccatcctgtgctgagctactgcagtgcgatttctttaac
aaagatggatttgcggaaagatttgctcaggagcttaggttaaagattcagaaagatgcc
agggaccatcctttgccaaaaaaatcaaaaattagcaaaaaggacaaagacgattcttta
ggagaagaaagaaaaatgcttgatatccaggacttcaacattgatccaaagatcaaagat
tctaaactgttcaaggtgaaattatccaaagctgaggtggagaaggctgacagatcttcc
aatatgagctgcctgtatgacagtggaaccagccagttcaaaacagtccctccgacaagc
atgaaagactccagcagcagtttggattacataaagaacccgggcatggttattcctccc
attatcccgaaccttgccaccatcacacccaatataagtgttaactctgggatgggaact
attcctggaacccataattacagagttgatgagaagactaaaaaatacttaacccctttt
ataaagcaagggaaacattcaccagcagggcattacaatgtcagcttgggcacatcggtc
tcaaatgaaaagaacgttcttcaggcaaacaagaaaagatgggaattctccaagacagat
gtgcgtttgcctgagctaaactataaccatctccctgaactcaaaggagtggacgctcga
aattccagatttgtcaaaaaggagaacaaaactgtctcagagtctcgcattccatccctt
gccagcatcgatcttcacaacccgagcctggctttgcaacagatctcgggaacatcactg
ccagatgcttcagaagccagcttccctcgagtagaacgctag

DBGET integrated database retrieval system