KEGG   Chrysemys picta (western painted turtle): 101934939Help
Entry
101934939         CDS       T04662                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00480  Glutathione metabolism
cpic00590  Arachidonic acid metabolism
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101934939 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101934939 (GPX7)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101934939 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 101934939
NCBI-ProteinID: XP_005284870
Position
Un
AA seq 259 aa AA seqDB search
MKGTGERQSTAKAVYLSYLPPKASTAGPPQAPTPRDYLAPAPAPSIGIYTLPRRGERPEA
GRETAEPPQREQQRWAGRVLPQAGTGSRAAKGTCQDTGEEEKHVQEIKGMETERQTRKVS
LVVNVASECGFTDSHYKALQQLQRDLGSHHFNVLAFPCNQFGQQEPDSNKEIESFARKTY
GASFPMFSKIAVTGAGANAAFKYLIESTGEEPTWNFWKYLVAPNGKVVKAWDSTVTVEEI
KPYITELLRKIILNQKDEL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggacgggggaaaggcagagcactgctaaggctgtgtacctgtcatacctccca
cccaaggcttccacagcaggcccgccccaggctcccacccccagggactatttagcgccc
gcacctgccccctccatagggatttacaccctcccccgcagaggagagaggccagaagca
gggagagaaactgcggagcctccccagcgggagcagcagcggtgggcagggcgggtccta
ccacaggcgggcaccgggagcagagcggcgaagggaacgtgccaggacaccggggaggag
gaaaagcatgtgcaggagatcaaaggcatggagacagagaggcaaacaagaaaggtatct
cttgtcgtcaatgttgcaagtgagtgcggatttacagatagccactacaaagctctacaa
cagttacagagagaccttggctcacatcattttaatgtgctagcattcccatgtaatcaa
tttgggcagcaagagccagacagtaacaaagaaattgagagctttgcccgaaagacttat
ggtgcctcctttcctatgttcagcaaaattgcagtcacaggtgctggtgctaatgctgcc
ttcaaatatttaattgaatccacaggagaagaaccaacctggaacttctggaagtacctg
gtagcccctaatgggaaagtagtaaaggcttgggactcaactgtcactgttgaagaaata
aaaccttacatcactgaacttttgaggaaaatcatcctgaaccagaaggatgaactgtga

DBGET integrated database retrieval system