KEGG   Chrysemys picta (western painted turtle): 101935211Help
Entry
101935211         CDS       T04662                                 

Gene name
RASSF5
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101935211 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA IBP39 Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 101935211
NCBI-ProteinID: XP_005306503
Position
Un
AA seq 316 aa AA seqDB search
MTQGKAEAAACFGVVTKRIRKIFRHFPKSKSWSEGLHLLRRPSREVLLVKDCKYTCHQEC
RSLIQLDCSQQGQPQNKPSPENTLTQNCSQNVTKAVAEEKPKAPTTQEIEQIINSYNAKV
TNCFVMKLNEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDALKEVNLADMTDKRTSFYL
PLDAVKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKEMQRDGQVLFQKLSLTEYPL
YLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLMILDREEKDKIQQVQKKYSKF
KQRLEETLKEAGGKPG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagggaaagcagaggcagccgcttgctttggggttgtaacaaagagaatacgc
aagatattcaggcattttcccaagtcgaaatcttggtccgagggtctccacctactcagg
aggcccagcagggaggtcttactggttaaagattgcaaatatacttgccatcaggaatgc
agaagcctgattcagctggactgcagccaacaaggacagccccagaacaaaccctcgcca
gaaaatacactgacgcaaaactgcagccagaatgtaacaaaagcagtagcagaagaaaaa
cccaaagctcccactacccaggagattgaacagataatcaacagttacaatgccaaggtt
acaaattgcttcgtgatgaagctgaatgaggatggcacttacacgggcttcattaaagtg
cacttgaaactgcgccggcctgtgacagtgccagcagggattcggccacagtctatctac
gatgccctcaaggaggtgaatctggctgatatgacggacaagagaacgtccttctacttg
ccactggatgcagtcaagcagctgcacatcagcagcacgaccacagtcagcgaggtgatc
cagggcctcctcaagaagttcatggtggtggacaaccctcagaagtttgcacttttcaag
gagatgcagagagatgggcaagttctcttccagaagctctctctaacagaataccccttg
tatctccggctgctggctggacctgacacagatgttctcagttttgtgctgaaggaaaat
gaaacgggggaagttgagtgggatgcattctcgatcccagagctacaaaatttcttaatg
atactggacagggaggaaaaagacaaaattcagcaagtacaaaagaagtacagcaagttt
aaacaaagactggaggagactttgaaagaagcaggaggaaaacctggataa

DBGET integrated database retrieval system