KEGG   Chrysemys picta (western painted turtle): 101936092Help
Entry
101936092         CDS       T04662                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 9-like
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101936092
Enzymes [BR:cpic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101936092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro Pilosulin
Motif
Other DBs
NCBI-GeneID: 101936092
NCBI-ProteinID: XP_005294847
Position
Un
AA seq 268 aa AA seqDB search
MRRESCLRDLIEKKFGCMSLLKSIRCPLEVYKKSLKEGIEISVWVDDMTRHNADALVNAA
NEHLDHIGGLALALVKAGGPEIKQESKRYIDRHGTLTTGQIVVTGGGKLSCKKVIHTVGP
RWSANESERCCHMLETAIINVLKYVNAPENNIKSVAIPAVSSGIFGFPLDLCAHVIVRTI
KNFVELAPLFGWFKEIHLVNITEPTVAAMKKACEELLGRSDINSLQETPPASANRLPDSI
TINGLCLHIIRGHIEDQQVSLHDGARRP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagagagctgtctacgtgacctcattgaaaagaagtttggttgcatgtctctc
cttaagagtataagatgtccccttgaagtatacaagaaaagcctgaaggaaggaattgag
atatctgtttgggtggatgatatgacaagacataatgctgatgctttggtgaatgcagcc
aatgaacatctggaccatattggaggccttgctcttgccctggtgaaagctggtgggcca
gaaattaagcaagagagtaaacgttatattgatcgccatggaacactcaccactggccaa
atagtagtgacaggtggaggcaagctttcttgtaagaaagttatccacacagtaggtcca
agatggtctgcaaatgaaagtgagagatgttgtcacatgcttgagacagctattataaat
gtcctgaaatatgttaatgctccggagaataatataaagtctgttgcaatccctgcagtg
agctcaggaatttttggcttcccactagatttatgtgctcatgtgatcgtacggactata
aagaattttgttgagctagctccattatttggctggttcaaagaaatccacttggtgaac
attactgagcccacagttgcagcaatgaaaaaggcctgtgaagagttgctgggcaggagt
gacatcaactcacttcaggagactccaccagcttcagcaaaccggcttccagattccatc
acaatcaatggtctttgcctacacatcataagaggacacattgaagatcagcaagtaagt
cttcatgacggagcacgaaggccctga

DBGET integrated database retrieval system