KEGG   Chrysemys picta (western painted turtle): 101936810
Entry
101936810         CDS       T04662                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cpic03000]
    101936810 (AHRR)
Transcription factors [BR:cpic03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101936810 (AHRR)
SSDB
Motif
Pfam: PAS PAS_3 HLH PAS_9 PAS_11 PAS_4
Other DBs
NCBI-GeneID: 101936810
NCBI-ProteinID: XP_005296587
Position
Un
AA seq 750 aa
MLGGKGGNPFRNKIKIGRPAIGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISKLDKL
SVLRLSVSYLRVKSFFQAIQEKHFRKQVGHTIKDHLSSETAIPEGGLLLESLNGFALVVS
SDGMIFYASSTILDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQLVSGQQLQ
TETGEEYILSKLFKAQECDSMPTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLF
GQKKKSSSGTILPPQLSLFCIVAPLLLPSVTELKMKSLFVKAKHKADDASTMDTNSNAIS
GLCETELQGRTSYHEGAAFTNVLQNAENQIKANNGENGISLFKVLTNEDHWVWVQANTQV
LYRTGCSEYVIASQQALKEEDVHLKVPKNITSLKGHKEALNYNCAIETLGQMKHLNWTAV
KNEQDSIKVKFEPNTNDKCFMQEESLNSNTLLLGIQNNWNTNNIWTLKNSSSSCSENQRM
NTCPSRKVGPFCNRDQSLLNLASTCPSHWGTTENCQSYSGLQQFTVENYTTDPVKLQRPL
MYPETLCDTVFPLDMPIKTEYDSDSENVADSYMMSQSQVWLDENGMVKKQLIGYPNTVHL
KTESDLSEQLSPCQKPKHCAYTPHNWQCIVTNHTNNMNINRPCKGLHNKEMTQICPQNSA
CLESIHDFQRTDFYNQFYNPNSVEEKEQNNQIFKMQYEFKNPCLVHTIKREPLDSPPLSD
NGQDGIEMIFPENALPDPVPHKTTDCTFLQ
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgctgggaggaaaaggaggaaacccgttcagaaacaagatcaagataggaaggcctgcc
attgggaatgaaaagtctaatccttctaagagacatagggaccgtttgaatgctgaatta
gatcatctggccagcctcctgcctttcccacctgacataatatctaagttggacaaactt
tctgtcttgcgccttagtgtcagctatctccgagtcaaaagcttctttcaggccattcaa
gaaaagcactttaggaagcaagttggtcacacaataaaagaccatctatccagtgagact
gccataccagaaggtggacttctactagaatcactgaatggttttgccttggtggtgagt
tcagatggaatgatattttatgcatcatcaactattttggactatctaggctttcatcag
actgatgtaatgcaccaaaatatatacgattacattcatgtggatgatcgccaagatttc
tgtagacaactgcactgggccatgaatcctccacaattagtgtctggacaacaattgcag
acagaaacaggagaagaatacattctcagtaagttgtttaaggcacaagagtgtgacagc
atgccaacagattattcttcctttttaactcgttgtttcatctgtcgagtccgctgcctg
ttggacagtacttccggtttccttacaatgcagtttcaaggtaaactgaagtttctcttt
ggacaaaagaagaagtcctcttcaggaacaatattaccacctcagctgtccttattctgc
atagtggcaccacttctgctcccttctgtgacagagctgaagatgaaaagtctgtttgtg
aaagcaaaacacaaagctgatgatgcatccacaatggatacaaattcaaatgctatttca
ggtctatgtgaaacagaattacaaggaagaaccagttaccatgaaggtgcagctttcact
aatgtgttacaaaatgctgaaaaccagatcaaagcaaacaatggagaaaatggcatttct
ctgttcaaagtactaacaaatgaagatcactgggtctgggtacaagctaatactcaagtt
ctgtacaggactggctgttcagaatacgtcattgcctcacagcaagctctaaaggaagaa
gatgtgcacctgaaggtaccaaagaacatcacaagtttgaaaggacacaaggaagcactt
aactataactgtgccattgaaactttgggacagatgaagcatcttaactggacagctgta
aaaaatgaacaggatagcataaaagtgaaatttgaacctaatacaaatgacaagtgtttc
atgcaagaggaatctctcaattctaacacattacttttaggtatccaaaacaactggaac
acaaacaacatttggactttaaaaaattcatcaagttcttgttctgaaaatcaacgcatg
aatacatgtccgagcagaaaagttggaccgttctgtaacagagatcaaagtcttttaaat
ttagcatcaacctgtccttcccactggggtactacagaaaattgccagtcttattcaggc
ttacagcaatttacagtggagaactacactacagatcctgtgaaattacaacgtccactg
atgtacccagaaactctatgcgacacagtatttcctctagatatgcccatcaaaactgaa
tatgattctgattctgaaaatgtagctgatagctacatgatgtcacaaagtcaagtgtgg
ctggatgagaatggtatggtgaaaaagcagctgattggctaccctaacacggtgcacctt
aaaacagaatcggacctcagtgagcaactgtctccttgtcaaaaaccaaagcactgtgct
tacacaccacacaattggcaatgcattgtaacaaatcataccaacaatatgaatataaac
agaccatgtaaagggttacataacaaagagatgacacagatttgcccccagaactctgca
tgtttggaaagcatccatgactttcagcgtacagacttctacaatcagttctataacccc
aattcagtagaagagaaagagcagaataaccagatttttaagatgcaatatgagtttaaa
aatccctgcttggttcacacaatcaagcgtgaacccttggattctccaccattgtctgat
aatgggcaggatggaatagagatgatcttccctgaaaatgcattaccagatcctgtgcct
cataaaacaacggactgtacatttttacaatag

DBGET integrated database retrieval system