KEGG   Chrysemys picta (western painted turtle): 101937595
Entry
101937595         CDS       T04662                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101937595 (RDH5)
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101937595 (RDH5)
SSDB
Motif
Pfam: adh_short GCN5L1 adh_short_C2 KR
Other DBs
NCBI-GeneID: 101937595
NCBI-ProteinID: XP_005308504
Position
Un
AA seq 411 aa
MLSRLLREHQAKQSERREQQERRRREAIAAATCLTEALTDHLNVGVAQAYVNQRKLDHEV
KTLQIQAAQFAKQTGQWINMVENFNQALKVPAMWLYVGLVALVWALGWYLRDRQTLASVQ
DKHVFITGCDSGFGHMLAKRLDRKGFRVLAGCLTQKGADNLQRTSSAGLRATLLDVTSSE
SIRRAAAWVQAEVGEKGLFGLVNNAGVANPIGPTEWMRIQDFRQVLAVNTFGLIEVTLAL
LPLLKRARGRVVNTSSVLGRLSANGGGYCVSKYTVEAFSDSLRRDMYHFGVRVSIVEPGF
FKTAVTSLDAIEASLQELWSQLAPEARQSYGEDFFQQYLKVQRLIMNFICDPDLSKVTSC
MEHALQAKHPRTRYSAGWDAKLLWLPASYLPAFLVDVVLATILPKPARRSR
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgctgtcccggctgctgcgcgagcaccaggccaaacagagcgagcggagggagcagcaa
gagcggagacggagagaggccattgctgcggccacgtgcctgactgaggccctgacggac
cacctgaacgtaggggtggcccaggcctatgtgaaccagagaaagttggaccatgaggtg
aagacgctgcagatccaagctgcccagttcgccaagcagacgggccagtggatcaacatg
gtggagaacttcaaccaggcgctcaaggtgccagccatgtggctctacgtgggcctggtg
gccctggtgtgggcgctgggctggtacctgcgggaccgccagaccctggccagtgtccag
gacaagcacgtcttcatcacgggctgcgactcgggcttcgggcacatgctggccaagcgg
ctggacaggaagggcttccgggtgctggccggctgcctgacccagaaaggagccgacaac
ctgcagcgcaccagctcggccggcctgcgggccaccctgctcgacgtgaccagcagcgag
agcatccggcgggccgcggcgtgggtgcaggctgaggtgggggagaaaggtctcttcggg
ctggtgaacaacgcgggggtggcgaaccccatcggccccaccgagtggatgcggatccag
gatttccggcaggttctggccgtcaacaccttcggcctcatcgaggtgaccctggcgctc
ctgccgctgctgaagcgggcgcggggccgcgtggtcaacacgtccagcgtgctggggcgg
ctctcggccaacgggggcggctactgcgtctccaagtacacggtggaggccttctccgac
agcctgcggcgggacatgtaccacttcggggtgcgcgtgtccatcgtcgaacccgggttc
ttcaagacggccgtgactagcctggacgccatcgaggcctcgctgcaggagctgtggagt
cagctggcgcccgaggccaggcagagctacggggaggatttcttccagcagtaccttaag
gtgcagcgtctcatcatgaacttcatctgcgaccccgacctgagcaaggtgaccagctgc
atggagcacgcgctgcaggccaagcacccgcgcacgcggtacagtgccggctgggacgcc
aagctgctctggctaccggcctcctacctgccggccttcctggtggatgttgtgctggcc
acgatcctgccgaagccggctcgccgcagccgctag

DBGET integrated database retrieval system