KEGG   Chrysemys picta (western painted turtle): 101937747Help
Entry
101937747         CDS       T04662                                 

Gene name
ACVR1
Definition
(RefSeq) activin A receptor type 1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04060  Cytokine-cytokine receptor interaction
cpic04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101937747 (ACVR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101937747 (ACVR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101937747 (ACVR1)
Enzymes [BR:cpic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101937747 (ACVR1)
Protein kinases [BR:cpic01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   101937747 (ACVR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS APH Haspin_kinase FTA2 TMEM154
Motif
Other DBs
NCBI-GeneID: 101937747
NCBI-ProteinID: XP_005296984
Position
Un
AA seq 519 aa AA seqDB search
MDTFLSRSTMIDGVMILSVLLLLAFPSPSLEDELNLNMVHYECVCEGMSCGNGDRCRGQQ
CFASLSINDGTKVYQKGCFQVYEQGKMTCKTPPSPDQAVECCQGYLCNMNITAQLPTKGQ
TLQGEAVGYSMEMLVIVILAPVIVLIIFSALAVLIIRKIQQNHMERLNARDAEYGTIEGL
ITSNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGQWQGE
NVAVKIFSSRDEKSWFRETELYNTVLLRHENILGFIASDMTSRNSSTQLWLITHYHEMGS
LYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAISHRDLKSKNILVKKNGQC
CIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLV
LWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSL
AKLMKECWYHNPSARLTALRIKKTLTKIDNSLDKLKADC
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggatacatttctgtcgagatctacaatgatagatggagttatgattctttccgtgctg
ctgctgctggcttttccatcacccagtctggaagatgagctgaatctaaatatggtccac
tacgagtgtgtgtgtgaaggcatgtcctgtgggaatggagatcgctgccggggccagcag
tgctttgcctccctgagcataaatgatggcactaaagtttaccagaagggctgcttccaa
gtctatgaacaggggaaaatgacatgcaaaacacccccatctcctgaccaagctgtcgag
tgctgtcagggatatttgtgcaacatgaatatcacagcacaattgcctactaaagggcaa
accctccagggagaagctgtgggttacagcatggaaatgctagtcattgttatactggct
ccggtgatagtgctgataatattttcagcgttagctgtgctgattattcgaaaaatacag
caaaaccacatggaaaggctcaatgctagggatgcagagtacggcacaattgagggactc
attacatcaaacgttggcgacagtacattggcagacttattggaccattcctgcacatct
ggaagtggctctggtcttcctttcctggtacaaagaacagtggctcgtcagattacgctc
ttagagtgtgtaggaaaaggcagatatggagaggtctggaggggtcagtggcaaggagaa
aacgttgcagtgaagatcttttcttcacgagatgaaaaatcctggttcagggaaactgaa
ttgtacaacactgtgttactgcggcatgaaaatattttaggttttattgcatcagatatg
acttctagaaactccagcacccagttgtggttaattacacactatcatgaaatgggatct
ctgtacgactacctacaactcactacactagacactgtcagctgcctacgaatagtcctg
tccatagccagtggtcttgcacacttgcacatagagatatttgggacccaggggaagcct
gccatttcccatcgggacttgaagagcaaaaatatccttgttaaaaaaaatgggcagtgc
tgcatagcagatttaggtcttgcagttatgcattcccaaagcactaatcagttggatgtg
gggaacaacccccgtgtgggtaccaagcgctacatggcgcctgaagtcttagatgaaacc
attcaagtggactgttttgactcttataaaagggttgacatctgggcttttggactagtc
ctctgggaagtagctagacgcatggttagcaatggtattgtagaagactataaacctcca
ttctatgatgtggttccaaatgaccctagttttgaagatatgagaaaagtggtctgtgtg
gatcagcaaaggccaaacattcccaacagatggttctcagacccaacactaacctctctt
gccaagctgatgaaagaatgctggtatcacaatccatcggcaagactaacagccctgcgt
atcaaaaagactttgaccaaaattgataattccttagataaactgaaagctgactgttga

DBGET integrated database retrieval system