KEGG   Chrysemys picta (western painted turtle): 101938245
Entry
101938245         CDS       T04662                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic04080  Neuroactive ligand-receptor interaction
cpic04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101938245 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101938245 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 101938245
NCBI-ProteinID: XP_005310961
Position
Un
AA seq 77 aa
MSVRRWLLALLLLWLALSAGSGAPLSEVPDGRDLEKGNIRNLVHPKGMRNGAGHRQNGWR
KSRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgagcgtgcggcgctggctgctggcgctgctgctgctctggctcgccctgagcgcgggc
tccggagcaccattgtccgaggtgccagatggcagagacctggagaaagggaatatccgg
aacctggtgcaccccaaggggatgcggaatggagcaggacaccggcagaatggctggcga
aagtcccggcgtccaagaccccgtctctcccacaagggccccatgcctttctag

DBGET integrated database retrieval system