KEGG   Chrysemys picta (western painted turtle): 101939630Help
Entry
101939630         CDS       T04662                                 

Gene name
EIF3CL
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101939630 (EIF3CL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cpic03012]
    101939630 (EIF3CL)
Translation factors [BR:cpic03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    101939630 (EIF3CL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 101939630
NCBI-ProteinID: XP_008174879
Position
Un
AA seq 683 aa AA seqDB search
MKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYVRILADLEQYLNELWEDKEGKKKM
NKNNAKALSTLRQKIRKYNRDYESQISSYRQNPEQSADEDEERKSDDSEGSSSSEDDDDG
EGMSAAAFLKKKEPSGDSRSKFLKKMEVRALPGVRGGGGIAHVWQFPACPGGGATTLPLC
VPPEMWKKCLESIDELLDMLFANPNIFIGENILEESENLSNFEQPLRVRGCILTLVERMD
EEFTKIMQNTDPHSQEYVDHLKDEGRVCGIIGRVQSYLQEKGTTEEICRGYLRRVLHTYY
KFDYKAHQREQGPAGDSKILYNRTMVQGPGCVCGAWGGAVGAGRGAGWGQAVGRRGAVGG
RPWGGAGRLSPLSPQILYNRTMVQLGICAFRQGMTKDAHNALLDIQSSGRAKELLGQGLL
MRSLQERNQEQEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMIS
KQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWRTCHRFIINEKMNGKVWDLFPE
ADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMEILSDMFQLDLPTVHSIISKMIINEEL
MASLDQPTQTVVMHRTEPTALQNMALQLAEKLGNLVENNERVFDHKQGTYGGYFRDQKDG
YRKNEGGYMRRGGYRQQERQANY
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgggacgtaaccaagtgcctggaggagttcgagctgctgggcaaggcctac
ggcaaggccaagagcatcgtggacaaggagggcgtcccccgcttctacgtgcgcatcctg
gccgacctggagcagtacctcaacgagctgtgggaggacaaggagggcaagaagaagatg
aacaagaacaacgccaaggccctgagcaccctgcggcagaagatccgcaagtacaaccgg
gactacgagagccagatcagcagctacagacagaaccccgagcagtcggcggacgaggac
gaggagaggaagagcgacgactcggaaggctcctcttcctcggaggacgacgatgatggc
gagggcatgagtgcggccgccttcctgaagaagaaggagccctcgggcgactcacgcagc
aagttcctcaagaagatggaggtgagggcgctccctggcgtgcgtggggggggtggcatt
gcccatgtgtggcagttcccagcatgccctggggggggtgccaccaccctgcccctatgt
gtccctccggagatgtggaagaagtgcctggagagcatcgacgagctgctggacatgctc
ttcgccaaccccaacatcttcatcggggagaacatcctggaggagtcggagaacctgtcc
aacttcgagcagcccctgcgggtgcgcggctgcatcctgacgctggtggagcgcatggac
gaggagttcaccaagatcatgcagaacacggacccgcactcccaggagtacgtggatcac
ctgaaggacgaggggcgggtgtgcgggatcatcgggcgggtgcagagctacctgcaggag
aagggcacgacggaggagatctgccgcgggtacctgcgccgggtgctgcacacctactac
aagttcgactacaaggcgcatcagcgggagcagggccccgccggcgactccaagatcctg
tacaaccgcaccatggtgcaggggccggggtgtgtgtgcggggcgtggggcggggcggtg
ggggcaggccgtggggcggggtgggggcaggccgtggggcggcgcggggcggtggggggc
aggccgtggggcggcgcgggccggctctcacccctctccccgcagatcctgtacaaccgc
accatggtgcagctggggatctgcgccttccggcaggggatgacgaaggacgcgcacaac
gcgctgctggacatccagtcgtccggccgcgccaaggagctgctggggcaggggctgctg
atgcgcagcctgcaggagcgcaaccaggagcaggagaagatcgagaagcggcgccaggtc
cccttccacatgcacatcaacctggagctgctggagtgcgtctacctggtgtcggccatg
ctgctcgagatcccctacatggccgcccacgagttcgacgcccggcgccgcatgatcagc
aaacagttccaccaccagctgcgcgtgggcgagcgccagcccctgctgggcccccccgag
tcgatgcgggagcacgtggtggcggcgtccaaggccatgaagatgggcgactggcgaacc
tgccaccgcttcatcatcaacgagaagatgaacgggaaggtctgggacctgttccccgag
gccgacaaagtgcgaaccatgctggtccggaaaatccaggaggagtcgctgcgcacctac
ctcttcacctacagcagcgtctatgactccatcagcatggagatcctgtcggacatgttc
cagctggacctgcccaccgtgcacagcatcatcagcaagatgatcatcaacgaggagctc
atggcctcgctggaccagcccacgcagacagtggtgatgcaccgcacggagccgaccgcc
ctgcagaacatggccctgcagctggccgagaaactgggcaacctggtggagaacaacgag
cgcgtcttcgaccacaagcagggcacctacggcgggtacttccgcgaccagaaagacggc
taccgcaagaacgagggcggctacatgcgccggggcggctaccgccagcaggagcgacag
gccaactactga

DBGET integrated database retrieval system