KEGG   Chrysemys picta (western painted turtle): 101940100Help
Entry
101940100         CDS       T04662                                 

Gene name
NPR2
Definition
(RefSeq) natriuretic peptide receptor 2
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00230  Purine metabolism
cpic01100  Metabolic pathways
cpic04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101940100 (NPR2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101940100 (NPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cpic01001]
    101940100 (NPR2)
Enzymes [BR:cpic01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101940100 (NPR2)
Protein kinases [BR:cpic01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   101940100 (NPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 101940100
NCBI-ProteinID: XP_005314616
Position
Un
AA seq 363 aa AA seqDB search
KLWTAPELLQQGRLPPPGMQKADVYSFSIILQEIALRNGPFYIEGMDLSPKEIVQKVRNS
QKPYFRPSIDLGLHSEELAVLMERCWAQEPAERPDFTQLKIFIRRFNKEGSTSILDNLLS
RMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIY
FSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNG
KLHANEIVRMALALLEAVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDT
VNTASRMESNGQALKIHISSTTKEVLDEFGCFELELRGDVEMKGKGKMRTYWLLGERTDD
SII
NT seq 1094 nt NT seq  +upstreamnt  +downstreamnt
agaagctgtggacggcccccgagctgctgcagcaggggcgcctgccccccccgggcatgc
agaaggcggatgtctacagcttcagcatcatcctgcaggagatcgccctgcgcaacgggc
ccttctacatcgagggcatggacctgagccccaaggagattgtgcagaaggtgcggaaca
gccagaagccgtacttccggccctccatcgacctgggtctgcacagcgaggagctggccg
tgctgatggagcgctgctgggcgcaggagcccgccgagcgccccgacttcacccagctca
agatcttcatccgcagattcaacaaggaaggcagcaccagcatcctggacaacctgctgt
cgcgcatggagcagtacgccaacaacctggagaagctggtggaggagcggacgcaggcct
acctggaggagaagcgcaaggccgagaacctgctctaccagatcctaccccactccgtgg
ccgagcagctgaagcgcggggagacggtgcaggccgaggccttcgacagcgtcaccatct
acttcagcgacattgtggggttcacagccctgtcggctgagagcacccccatgcaggtgg
tgaccctgctgaacgatctctacacctgcttcgacgccatcatcgataacttcgacgtgt
acaaggtggagacgattggagacgcctacatggtggtgtcggggctgccggtgcggaacg
ggaaactgcacgccaacgagatcgtccgcatggcgctggcgctgctggaggccgtgaaaa
ccttcaaaatccgtcatcggcccaacgaccagctccggctgcgcatcggcatccacaccg
gtcctgtctgtgccggggtcgtagggctgaagatgccccggtactgcctgtttggggaca
cggtgaacactgcctcgcgcatggagtccaacgggcaggcactgaagatccacatctcgt
ccaccaccaaggaggtcctggatgagttcggctgcttcgagctggagctccgaggggacg
tggaaatgaaggggaaagggaagatgcggacgtactggctgctgggcgagcggacagacg
acagcatcatctga

DBGET integrated database retrieval system