KEGG   Chrysemys picta (western painted turtle): 101940111
Entry
101940111         CDS       T04662                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cpic01002]
    101940111 (ADAMTS13)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     101940111 (ADAMTS13)
Peptidases and inhibitors [BR:cpic01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   101940111 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_spondin ADAM_spacer1 TSP1_CCN CUB
Other DBs
NCBI-GeneID: 101940111
NCBI-ProteinID: XP_005293308
Position
Un
AA seq 1224 aa
MGSEGYRNSVDLVWSDCSREQFLAFLRTGQASCLNDLPDLEGSIPGWKPGLYYGADEQCK
IAFGSAATACTFARNDIDMCRVLSCHTHRADQTSCTRLLVPLLDGTECGINKWCSKGRCS
SLEELTPVAVVHGQWSSWSPLTACSRSCGGGVVTRRRLCNNPRPAFGGQECRGADLQAEM
CNTQACLTSQLEFMADQCAATNVKPLYLIPEVPFFYKWTSAAAYAKGDTLCKHMCKAEKK
NFMVSRGVSFTDGTRCEQNNGRAEAAFDLCVMGSCRVFGCDGRMDSGMVLDSCRVCGGDN
ATCTRVSGSYAEGKAKEYVTFLALPHKTTLVYVANRKPLFTHLAVKVQGRYVVAGRERIS
LNTTYPSVIEDNQIKYRVFLTEDNLPSLEEVHVDGPTQEDIEIQVYRKYGKEYGDVTNPD
ITFSYFIPKEKQTHVWIPQFRTCSVSCGEGVLLVDHSCFDQTRNEITDDQQCLETPQPSS
RQEPCAMAPCPQGWVAGDFGPCSATCGGGAMERLVRCMKKEGGLILTLPDSKCTDAPKPA
STKACSTEPCPIRWKESELGKCSAICGVGVTQQNVTCVQILDGLETTVDDSLCPAEEKPL
AFVPCVVNICPLGWNTDNSPSREELVPFGSIQKENHSVHVWSPLVGECTVTCGGGVAQLR
YVCVAFETKEETQEKHCNQVPKPASRLESCNPMLCPPSWEVKELAACPVSCGGGRIPLSL
RCVRQEGNTTRPLPHSKCGRMPRPDSTKECGTDPCPARWHYKMDSCSASCGGGVLRRVLY
CARETGDKVEEIVADAQCHGLPRPEEQELCNLEPCPPRWKVAATGSCSSSCGLGLATQLI
TCVQLRQGLETELEESSCPEAEKPLPSIPCFIRMCSYEWGFSEWTECSASCGNGIQMRQD
FCLNPKTHEHVNPVFCMRSPKPITVRGCSASPCPEQPAVDGYLGTEHQIPTSATNPITTA
ATIYPERPEYEALDRLPTRVLAPSPKRPEELSAGEEDTDEVYSVCGRLFLNSTGVINMTG
LQVSDCTVSIGRPLGEVVTVQVLESSLNCSAGEIVLFSGRTMWRTGCKKLMVSSVNSRTN
TLMVRQRLLLPGNGVVLQYNSKAAAKKYYQDCDVQLFGPWGEIVNPGQLPDPKRQVACRT
FINVAPRYRIAIHALYMDLGTENNQTHSNYISIRDVNAMKTTVFRGKQLFFWESTGSQAE
IEFNEGFTEDRVSFRAEYWVRKPR
NT seq 3675 nt   +upstreamnt  +downstreamnt
atgggctccgaaggctaccgcaacagtgtggacctggtctggtcggactgcagcagagag
cagttccttgcctttctcaggacaggccaagcaagctgcttgaacgacctgccggacctg
gagggcagcatccccgggtggaagcctggcttatattacggcgcagacgagcagtgtaaa
atagccttcgggagcgcagccacggcgtgcacctttgccaggaatgacattgacatgtgc
agagttctctcttgccacacccatcgggctgaccagaccagctgtacacgccttcttgtt
ccccttctggatgggaccgagtgtgggatcaataagtggtgctccaagggacgctgtagc
tctctggaagagctgacccctgtggcagtggtgcatgggcagtggtccagctggagcccc
ctcaccgcttgctcccgcagctgcggaggaggagttgtaacgagaagacgactctgtaac
aaccccaggcctgctttcgggggtcaggagtgcaggggagcagacctccaggctgagatg
tgcaatacgcaggcctgtttgacctcccagttggagtttatggctgaccagtgtgccgcg
acaaatgtaaagccgctgtatctcattccagaagtcccgtttttttataagtggacgtcg
gctgcggcttatgccaaaggggataccctgtgcaaacacatgtgcaaggcagagaagaag
aatttcatggtgagccgtggggtcagtttcaccgatggaacccggtgtgagcagaacaac
ggcagagctgaagcggctttcgatctgtgcgtgatgggcagctgcagggtgttcggctgt
gacggcaggatggactctgggatggtgctggactcctgcagggtgtgcgggggagacaac
gccacgtgcaccagagtgagcggctcttacgcagaaggaaaagccaaagagtatgttaca
tttctagccctgcctcacaagaccaccctcgtctacgttgccaatcgcaaacccctcttc
acacatttggctgtgaaggtccaaggtcggtatgtggtggccgggagggagagaatctcc
ttgaacaccacctatccgtcggtaatagaggacaaccagatcaaatacagggtgtttctc
accgaggacaacctgccaagcctggaggaagtccatgtcgatgggccaacccaagaggac
attgagatacaggtttataggaagtatgggaaagaatatggagatgtcaccaacccagac
atcaccttcagctactttataccaaaggagaaacagacacatgtgtggattcctcagttc
aggacctgctcggtgagctgtggggaaggggtgctactggtcgatcactcctgctttgac
cagaccaggaatgaaataacagatgatcagcagtgcttggaaacgccacagccctcttcc
aggcaggagccctgtgccatggcaccatgcccacaaggctgggtggcgggggacttcggc
ccctgcagtgccacatgtgggggtggagcgatggagcggctggttcgctgtatgaagaaa
gaagggggcttgatcctgactcttcccgattccaaatgcacggatgctcccaaacctgcc
tccaccaaggcatgcagcactgagccgtgtcccataagatggaaggaatctgagctgggc
aaatgctctgccatctgtggggttggagtcacccagcagaacgtgacctgtgtccagatt
cttgatggactggagaccacagtagacgacagcctgtgcccggcggaagaaaaacctctc
gcttttgtgccatgtgtggttaacatctgtcctctaggctggaacacagacaattcgccc
tcacgggaagagctggtgccatttgggagtatccagaaggaaaatcactcggtgcatgtc
tggagccctctcgttggcgaatgcaccgtgacctgtggcggaggtgtggcccagcttcgt
tatgtctgtgtggctttcgagaccaaagaagaaacccaagagaaacattgtaatcaagtg
ccaaagccagcgagcaggctggaaagctgcaatcccatgctgtgccctccaagttgggag
gtgaaggagctggctgcatgcccagtgagctgtggaggagggagaataccactctctctt
cgctgtgtaagacaagaaggaaatacaacccgtcctcttcctcattccaaatgtggtagg
atgcccaggccagacagcaccaaggagtgcggtactgatccatgcccagcaaggtggcat
tacaaaatggactcgtgcagcgctagctgcggaggaggtgtgctgcgcagggtcctgtac
tgtgcgagggagaccggggacaaggtggaagagattgtagcagatgcacagtgtcatggt
ttgcctcgcccagaggagcaggagctgtgtaatctggagccgtgccctccaagatggaaa
gtagcagcgactggttcgtgttcctcttcttgtgggctcggcttagccacacaattgatt
acctgcgtgcagctccgccaaggcctagagaccgagctggaagagagttcgtgtccggag
gccgagaaacccctccccagcatcccctgtttcatcagaatgtgctcctatgagtggggt
ttcagcgaatggacagagtgctcagcgtcgtgtgggaacggcattcagatgcggcaggat
ttttgcctcaatccgaaaacccacgagcacgtgaaccccgtcttctgcatgcgctccccc
aagcctatcacggtgcgtggctgctctgccagcccctgtcctgagcagcctgcggtggat
gggtacttgggaacagaacaccagataccaacttcagctacgaacccgataacgacagca
gccaccatttatcccgagaggccggaatacgaagccctggatcgtcttccaaccagggtg
ctggctccttcacccaaacgccccgaggagctttcagcgggggaggaggacactgatgaa
gtgtacagtgtctgtgggaggctcttcctcaactccaccggggtcatcaacatgaccggc
ctgcaggtcagtgactgcacggtttccatcggacgccccttgggggaagtggtaacagtc
caggtgctggagagctccctaaactgcagtgcaggggagattgtgctgttttctggacgg
acgatgtggcggacaggctgtaagaagctgatggtgtcatccgtaaactccaggaccaac
acattgatggtgagacagcgcctcctgctgccagggaatggtgttgttcttcagtacaac
agcaaagcagctgcaaaaaaatattatcaagactgtgacgtgcagctgtttggtccctgg
ggtgaaatagtgaatccgggacagttgccggacccaaaacgacaagtggcatgtcggacc
tttatcaacgtggctccacggtatcgcatagccatccatgccctctacatggacctgggg
actgaaaacaaccaaacacactccaattacatctcgatacgcgatgtgaatgccatgaag
acaacagtgtttcgtgggaaacagctgttcttctgggaatcgacggggagccaggctgaa
attgaatttaatgaaggctttacagaagatcgtgtcagtttccgagcagagtactgggtc
agaaagcccagataa

DBGET integrated database retrieval system