KEGG   Chrysemys picta (western painted turtle): 101940255Help
Entry
101940255         CDS       T04662                                 

Gene name
AOAH
Definition
(RefSeq) acyloxyacyl hydrolase
  KO
K01065  acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101940255 (AOAH)
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     101940255 (AOAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL SapB_2
Motif
Other DBs
NCBI-GeneID: 101940255
NCBI-ProteinID: XP_008167894
Position
Un
AA seq 583 aa AA seqDB search
MRGSWQGFPPLFFSLLLLMLPLKDISTSPLSGRAQSTLVPGGSDNGHTCLGCVLVVSVIE
QLAMFHNCTAKEAIERLCNYLPEILNLQGICYLVAELYGAELIKLLKYKMNADVVCHSIK
LCKQNAGQPFCHLYPPPKMGLKKAIRKANRIVRNSKVLKNTDGFLNICALPPLVKLCEKI
KYVIKNKLPYEDFDGDKFSAFPTLRGYHWRGRDCNEGKAIVYPGRRPDNWDVERDSNCNG
IWGVDPKDGIPYEKKFCKDAESKGIILLGDSAGAHFHIPPEWMTAAQMSLKSFSNLPVAL
TNELDWPHFSGTTGFLNSTIGGWTDSLYLRLRRRNRCNHRDFQNISKNGGSSKNLLELMK
SLARNQLFDNPAIVIYASIGNDVCNGRPDTVAHMTTPNQMHSNVMQTLQYLNSQLPKGSH
VILTGLVDGRFLWDQLHSRYHPLGQLNKDITYGQMYSFLNCLQISPCNGWMSSNETLRNL
TSERALQLSNVLKEIARSEKFANFDIFYMDFPLGKIVDEWHKLGGESWQLIEPADGFHPS
QVKLTLGARIIWQKALSEWPHVLGKENPFNKQIEEVFKDQGGH
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagggggtcctggcaggggttcccccctctattcttctcccttctccttctcatgctt
cctctgaaggacatctcaacctcacctctgtctggtagagcccaatcaactctggtccct
ggtgggagtgacaatggacacacctgtcttggatgtgtgcttgtggtatcagtaattgaa
cagcttgcaatgtttcacaactgtacagcaaaagaagcaatagagagactctgcaactat
ctacctgaaatactgaacttgcaaggcatctgttatttggtagctgagctttatggagca
gaactaattaaactgttaaagtataaaatgaatgctgatgtggtatgccattccattaag
ctgtgtaaacagaatgcaggacaaccattttgtcatttgtaccctcctccgaagatgggg
ctgaaaaaggccataaggaaagcaaacaggattgtcaggaattccaaagttctgaaaaac
acagacggctttttaaatatatgtgcacttccccctctggtcaagctgtgtgagaagatt
aaatacgtcataaaaaataagttaccttatgaagactttgatggagataaatttagtgct
ttcccaaccttgaggggatatcactggagaggcagagactgcaatgaaggaaaagcaata
gtgtaccctggtagacgcccagataactgggatgtggaaagggattctaactgtaatggt
atatggggtgtagatccaaaagatggaattccatatgagaaaaaattctgtaaagatgca
gagtccaaggggatcattctgttgggagattcagctggagctcactttcacatccctcct
gaatggatgacagcagcacagatgtctctgaaatcattttctaatctcccagtggctctt
accaatgagcttgactggcctcatttctcagggaccactggatttctgaactccacaatt
ggaggctggacagactctctctatctacgtttacgcagaagaaaccgctgcaatcacaga
gacttccagaatatttccaaaaatggtggttcttcaaaaaatcttctggagttaatgaaa
agcttggctaggaatcaactgttcgacaatccagccatagttatctatgcttcaattggg
aatgatgtctgcaatgggagacctgacacagtggctcacatgactacacccaaccaaatg
cactccaatgtcatgcagacgctgcagtatctaaactctcaacttcctaaaggcagccat
gtgattttaacaggcttggtagatggtcgctttctgtgggatcaattacatagcagatac
catcctcttggtcagctaaataaagatatcacatatggacaaatgtattcattcctaaat
tgtcttcagatcagtccctgcaatgggtggatgtcttcaaacgaaaccctccggaacctc
acctcagagagagctttacagctttccaatgtcctgaaagaaatagcgagatctgagaag
tttgccaattttgatattttctacatggatttcccactggggaaaattgttgatgagtgg
cacaaactaggaggagaaagctggcagctgatagaaccggctgatggattccatcctagt
caagttaagctgaccctgggggcacgcattatctggcagaaggcactcagcgaatggccc
catgtgcttggaaaggagaatcccttcaataaacagattgaagaggttttcaaagatcaa
gggggacactga

DBGET integrated database retrieval system