KEGG   Chrysemys picta (western painted turtle): 101940914Help
Entry
101940914         CDS       T04662                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00232  Caffeine metabolism
cpic00983  Drug metabolism - other enzymes
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101940914
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101940914
Enzymes [BR:cpic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101940914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 Transglut_core
Motif
Other DBs
NCBI-GeneID: 101940914
NCBI-ProteinID: XP_005292393
Position
Un
AA seq 290 aa AA seqDB search
MYIEEYLARIGYKGSHEKHDLETLTAIFQHHIRTVPFENLSIHCEETITLDLDQVYNKIV
RKKRGGWCMEHNQLLCWVLKTLGYDTTLLGAYIYNLHQNTYASHMTHLLLKVDIDDRAYI
LDGGFGVSYQIWQPMELISGKDQPQTPGIFRFTENNGTWYFEKIRRKQYIANQSFSNSDL
LERSECRKIYLFSLEPRTIRDFQFQCTYLQTSPDSLFTKKSICSLQTTDGFRALIGWTLI
ETTYNYKDNTDLVEFMTLKDEEVEETLKDKFSLTLERKFVPINLKGLYVI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcgaagaatatttagcaagaattggatacaaaggctcccatgaaaaacatgat
ttggaaaccttaactgcaatcttccagcaccacatccgaactgttccatttgaaaatctc
agcatccattgtgaggaaaccattaccttggatttagaccaggtttacaacaaaattgta
aggaaaaagcgtggtggatggtgcatggaacacaaccaacttttatgttgggtgctgaaa
acactgggatatgacaccactcttttaggagcatatatatacaacctgcaccaaaacaca
tatgcttcccacatgacccaccttctgctaaaggtggatattgatgatagagcctatatc
ctggatggaggctttggtgtatcctatcaaatttggcaaccaatggaacttatttctggg
aaagaccagcctcagactcctggcatctttcgcttcacagaaaacaatgggacctggtac
tttgagaaaataagaaggaaacaatacattgccaaccaaagcttctctaattctgatctt
ctggaaagaagtgagtgcaggaaaatttacttgttcagtcttgagccacgaacaatcaga
gatttccagttccaatgtacgtatcttcagacatctccagattccctgtttacaaagaag
tcaatctgcagcctgcagaccactgatgggtttcgagctttaattgggtggacactcatt
gagacaacttacaactacaaggacaacacagatctggtagaattcatgactcttaaagat
gaagaggtggaggagacactgaaagataaattcagcttaacattagagagaaaatttgtc
ccaattaacctcaaaggattgtacgtgatttag

DBGET integrated database retrieval system