KEGG   Chrysemys picta (western painted turtle): 101942132Help
Entry
101942132         CDS       T04662                                 

Gene name
PHF6
Definition
(RefSeq) PHD finger protein 6
  KO
K23310  PHD finger protein 6
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cpic03000]
    101942132 (PHF6)
   03009 Ribosome biogenesis [BR:cpic03009]
    101942132 (PHF6)
   03036 Chromosome and associated proteins [BR:cpic03036]
    101942132 (PHF6)
Transcription factors [BR:cpic03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    101942132 (PHF6)
Ribosome biogenesis [BR:cpic03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   101942132 (PHF6)
Chromosome and associated proteins [BR:cpic03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    101942132 (PHF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 101942132
NCBI-ProteinID: XP_005301123
Position
Un
AA seq 423 aa AA seqDB search
MTSSIGQKKGSSRQRKCGFCRSNKDNECGQLLMSENQKVAAHHKCMLFSSALVSSHSDNE
SLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHKTYHYYCALHDKAQIREKPS
QGIYMILCRKHKKTTRNSEVQADMRSWKHPTIRCQGNRRSTFRKGGYSVWISVNSELCWR
YWFWGRKGCPLGILSFLHDLEEGVNEHELEPSPPKGKKRGRKGKPRKTNLKGQSEDTRST
SSHGTDEIESSSYRDRSPHRSSPSDTKPKCGFCHAGEEENEARGKLHIFNAKKAAAHYKC
MLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACIKTYH
YHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKSGSDHSSIPQQQL
NGN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacaagctcaattggacagaaaaaagggtcttcaaggcaacggaagtgtggtttttgt
aggtctaataaagataatgaatgtggacaactattgatgtctgaaaaccagaaggtggca
gcacatcacaaatgtatgctattttcgtctgcattggtatcttcacactctgataatgag
agtctcggtggattttctattgaagatgttcaaaaggaaataaaaagaggcactaaactg
atgtgctctttatgccattgtccaggagcaaccattggttgtgatgtgaaaacgtgtcac
aagacatatcactactactgtgcattgcatgataaagctcaaataagagagaaaccctca
caaggcatttacatgattttatgccgaaaacacaagaaaactacacgtaactctgaagtt
caagctgacatgagaagttggaaacacccaaccatcagatgccagggaaacaggagatcc
accttcaggaaagggggatacagtgtgtggatttcagtgaattctgagctttgttggaga
tactggttttggggcagaaagggctgtcctttaggaatcctcagctttcttcatgattta
gaagaaggtgtcaatgaacacgaattggagccttcacctcccaaaggaaaaaagaggggt
cgtaagggaaagccaagaaaaacaaatctcaaagggcagtcagaagacactagatctaca
tcctcacatggcacagatgaaatagaaagcagttcctatagagacaggtctccccacaga
agcagtcccagtgatacaaaacctaaatgtggattctgtcatgcaggtgaagaagaaaat
gaagctagaggaaagcttcatatatttaatgccaaaaaggcagcagcacactataagtgt
atgttgttctcttctggcactgtccagctaacaacaacatcaagggcagagtttggtgat
tttgatattaaaactgtacttcaggagatcaagagaggaaaaagaatgaaatgcactctt
tgcagtcagccgggggctactattggatgtgaaattaaagcctgtatcaagacttaccat
taccactgtggagtacaagacaaagctaaatacattgagaatatgtcacgaggaatttac
aaactctattgtaaaaaccatagtgggaacgatgaaagggatgaagaggatgaagaaaga
gaaagcaaaagccgtgggaaatcaggctctgaccatagtagcattcctcagcaacaactc
aatggaaactag

DBGET integrated database retrieval system