KEGG   Chrysemys picta (western painted turtle): 101942246
Entry
101942246         CDS       T04662                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cpic01009]
    101942246 (AKAP5)
Protein phosphatases and associated proteins [BR:cpic01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101942246 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101942246
NCBI-ProteinID: XP_005285949
Position
Un
AA seq 497 aa
MKKLEGRTTNMEKAAKEIQMENTGQSENPSAAKLCPSTEEQAEKLTMFCFKKRKKSCKKT
LEMKGVCEEDSVTLKHTSQSINSAPGEGEVSNQSQSSRGAWATIKRLVTPKRRSKSSRKQ
THSDSQVQLEINTEDPGLQSFPKNRVSSGLKIPCIRFSRGKKKPSHSEITEESDCSVKAN
ELMGILNKANSEPEDLAITVKSSMDQSFSQASEKSDRNSLNSTGKNALLVESRPDTDQHT
QCIVQSEITNPEAVAIMLQEKLHQKSLHETPEHTPVANKGVDLETTLSANVSKDLPDNVA
EATEVQETNSIDDTGLEYKESGRNINASEDCQSRERIMSFNQSAFKDDAVSVQSCSSEQL
KLEENKNTSGVSIVITITEADDEPDEEESNLDCKLSSITCEHKQKGNKKISGNLNFSKLS
NRKEGIVSGSGHRREAKVCSPARSPNGLSDQEHGTSEQYELLLIETAASLVKAAIQSSIE
QLVNEMALDHSKHNSVL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaagaaattagaaggcaggaccacaaatatggagaaggcagctaaagaaattcaaatg
gaaaacacaggacaatcagaaaatcctagtgcagcaaaactgtgcccttcaactgaagaa
caggcagaaaaactcacaatgttttgttttaagaaaagaaagaagtcctgtaagaagaca
ttggagatgaaaggtgtctgtgaagaagactctgtaaccttgaaacatacaagccaatcc
atcaattcagcccctggagaaggggaagtttccaaccaatctcagtcatcaaggggagcc
tgggcaactataaaacgtctagtgacacctaagagacggtcaaaatcttcaaggaagcag
acacactctgattctcaagtgcaactggagataaataccgaggatcctggcttgcagagt
tttccaaagaatcgggttagttctgggcttaaaattccctgtatacggttctcaagaggc
aagaaaaaacccagccattctgaaataacagaagaatcagattgcagtgttaaagcaaat
gaactgatgggcattttgaataaagctaacagtgaaccagaggatttggcaataacagtc
aaatctagcatggatcaatccttcagccaagcctctgaaaaaagtgacaggaactcactt
aattccactgggaagaatgcgcttttggtagagtccagaccagacactgatcaacacaca
cagtgcatcgttcagtcagaaataacaaatccagaggcagttgctataatgctccaggaa
aagctacaccagaagagcctacatgaaactcctgaacatacacctgtagcaaacaaggga
gttgatctcgaaaccacccttagtgctaatgtttctaaggacctaccagataatgtagct
gaagccacagaggtacaagaaacaaatagcatcgatgacacagggcttgaatataaagag
tctggaaggaacataaatgctagtgaagactgtcaatccagagagagaataatgagtttc
aatcagtcagcatttaaagatgatgcagtaagcgtgcagagctgttcaagtgaacaattg
aaattagaagaaaacaagaacactagcggagtgagcattgtgattacaattactgaagca
gatgacgagcctgatgaagaggagtcaaacctggactgcaagctgtcctccattacatgt
gaacataagcaaaaggggaataaaaaaataagtgggaacctcaatttcagtaaactttct
aatcgcaaagagggcatagtatcaggcagtggccacaggagagaggctaaagtctgttct
cctgctcggtcacccaatggtcttagtgatcaggagcacggcacttcagaacagtatgaa
ttgcttctgatagaaactgctgcttcacttgttaaggcagcgattcagtcatctatagaa
cagctggttaatgaaatggctttggaccatagtaaacataacagtgttctgtaa

DBGET integrated database retrieval system