KEGG   Chrysemys picta (western painted turtle): 101942815Help
Entry
101942815         CDS       T04662                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00250  Alanine, aspartate and glutamate metabolism
cpic00270  Cysteine and methionine metabolism
cpic00280  Valine, leucine and isoleucine degradation
cpic00350  Tyrosine metabolism
cpic00360  Phenylalanine metabolism
cpic00380  Tryptophan metabolism
cpic00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpic01100  Metabolic pathways
Module
cpic_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101942815
   00270 Cysteine and methionine metabolism
    101942815
   00280 Valine, leucine and isoleucine degradation
    101942815
   00350 Tyrosine metabolism
    101942815
   00360 Phenylalanine metabolism
    101942815
   00380 Tryptophan metabolism
    101942815
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    101942815
Enzymes [BR:cpic01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     101942815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 7tm_4 DAO Thi4 FAD_oxidored Pyr_redox_2 FAD_binding_3 Pyr_redox HI0933_like FAD_binding_2 AlaDh_PNT_C Pyr_redox_3 IlvN Shikimate_DH 2-Hacid_dh_C GIDA MCRA NAD_binding_7 Trp_halogenase RNA_pol_Rpb1_3 Lycopene_cycl ThiF
Motif
Other DBs
NCBI-GeneID: 101942815
NCBI-ProteinID: XP_008174921
Position
Un
AA seq 634 aa AA seqDB search
MELLLFSDFQAIILENLFGAPICNDAGFGGTQADQCQDGNWLMDMRFPLCHKANQLHTMS
LVYCSLNKINYFFCEAFILMAILWIYPAEGRSKAFSTCTSHITMVTVFYGSDIFVPLASS
YSHGVFLQLFLLVAFPSLESLPGKLKKWEQCFNDPDYDELVDIAKNGLEKKCNSKKVVIV
GAGISGLTAAKLLRDAGCKVLILEASGRLGGRIETYRERDWYMDLGPMRLPKHHRIVREF
IKQFRLKLNTFYNTDANAWYLVNNVRARYKDVEKNPDILRYPVHPAEKGKSATQLYEQTL
DKVTTDCSALKEKYDSFSTKEYLIKEGNLSRGAIDMIGDLLNEDGRFYMSFLHSVMTQVI
FSNNSYDEITGGFDQLSNAFYQYIHGSIQFHSPVVKILTKGDQVRVFYRRANTLVPLSVT
ADYVLVTTTAKAARLIKFSPPLSPLKTHALRSIHYSKDVKIALACTKKFWEKDGIHGGRS
ITDRPSRFIYYPSHNFPSGLGVILASYTWGDDAEIFISLSDEKCVDVVLEDLAEIHQVPK
DYIRSVCNKYVIKKWGLDRYSMGSYVSFTQYQYVDYSKALFQNEGRIHFSGELTAQPHAW
IDTAMKSALRAARNIHAVINASPGQQHELKENEL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgctgttttcagatttccaggccatcatcctggaaaacctctttggggct
cccatctgtaacgatgctggctttggtgggacccaagctgatcaatgccaggatggcaac
tggctcatggacatgaggtttcctctttgccacaaggcaaatcagcttcacaccatgagt
ctggtctattgcagcctgaacaagatcaactacttcttctgtgaggctttcatcctaatg
gccatcttgtggatctatccagctgaggggaggtccaaggccttctccacatgcacctca
cacatcaccatggtgacggtcttctatggttctgacatctttgtgcccttggcctccagc
tattctcatggagtatttcttcagctctttctccttgtggcattcccgagcttggagagc
ctgcctggcaaactgaagaagtgggaacaatgcttcaatgaccctgactatgacgaactg
gtggatattgccaaaaacggattggagaaaaagtgtaattcaaagaaggtggtgattgtt
ggggcaggaatcagtggactcacagctgccaaattgttgagagatgctggttgcaaggtt
ctgattctggaagccagtggccgcttgggagggcgcatcgagacctatcgagaacgagat
tggtacatggatctgggacccatgcgtttgccaaaacatcacaggattgtgcgtgaattt
atcaaacaatttagacttaaactgaatacattctataatactgatgcgaatgcctggtat
ttggttaacaatgtcagagcaagatataaagatgtggaaaaaaaccctgatatcttgcgg
taccctgtgcatcccgcagagaagggaaaatctgccactcaactttatgagcagacactg
gataaggtgacaacagactgcagtgctctgaaagagaagtatgattccttttccaccaag
gagtatttgattaaagaaggaaatttaagtagaggagccatcgacatgattggtgacttg
ctgaatgaagatggtagattttacatgtcatttcttcactcagtcatgactcaagttatc
ttctccaacaacagttacgatgagataacagggggattcgatcaactttctaatgctttc
taccagtatattcatgggagtattcagtttcactctccagtagtgaagatactaaccaag
ggtgaccaagtgagagtgttttaccgtagggcaaacacattggtccccttatctgtaacg
gccgactatgttcttgtcacaaccacggcaaaagctgcacggctcattaaattttctcca
cctctttctcctctcaagacccatgccctgcgctccattcactactcaaaggacgttaag
attgctttggcctgtactaaaaagttttgggagaaggatggaatccatggcgggagatca
atcactgatcgcccatccagattcatctactaccccagccacaatttccccagtggcctg
ggcgtgatcctggcttcctacacttggggcgatgatgctgaaatctttatttcccttagt
gatgaaaagtgtgttgatgtggtgctggaggacctggcagaaatccaccaggtgcccaaa
gattatatccggagtgtctgcaataaatatgtgatcaagaaatggggcctggacagatat
tccatgggctcatatgtttccttcacccagtaccaatatgtcgactactccaaggctctg
tttcagaatgaaggaagaatccatttttcaggagaactcacagcccagcctcatgcctgg
atcgacaccgctatgaaatctgctttgagagcagccaggaacatccatgctgttattaac
gcctcaccggggcagcaacatgagctgaaggaaaatgaactttaa

DBGET integrated database retrieval system