KEGG   Chrysemys picta (western painted turtle): 101942879Help
Entry
101942879         CDS       T04662                                 

Gene name
MARS2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cpic  Chrysemys picta (western painted turtle)
Pathway
cpic00450  Selenocompound metabolism
cpic00970  Aminoacyl-tRNA biosynthesis
cpic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101942879 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101942879 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpic01007]
    101942879 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpic03016]
    101942879 (MARS2)
Enzymes [BR:cpic01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101942879 (MARS2)
Amino acid related enzymes [BR:cpic01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101942879 (MARS2)
Transfer RNA biogenesis [BR:cpic03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101942879 (MARS2)
 Prokaryotic type
   Other AARSs
    101942879 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 101942879
NCBI-ProteinID: XP_005310983
Position
Un
AA seq 581 aa AA seqDB search
MLSLPARCLLRPPRRPLPAPFRWGSSGPGRRWLLSTPIFYVNGPPHIGHLYSALLADALH
RHRGLLGPGPGRLATGTDEHGLKIQQAAAAAGTSPSELCAHVSGLFRDLFSRAAVSFTDF
IRTTEPRHHRAVQCFWAALQGRGLLYKDFYEGWYCTPDECFLTQGQITERPDAQGRPCKV
SLESGHQVHWTKEENYMFKLSEFQEPLRKWLQGNRHVISPEPFYQVVLRWLEEDLPDLSV
SRERSRLQWGIPVPGDSTQTIYVWVDALVNYLTVAGYPDAHHAWWPAAHHVVGKDILKFH
AIYWPALLMAVGLDPPEQIYVHSHWTVHGQKMSKSLGNVVDPVACFKQYTVDGFRYFLLR
QGVPERDCDYYEEKVIKLVNSELADALGGLLNRCTAPSINPSGIYPHFSESCFRKSSDHM
DVEASGRALAEDYELVASVDRLPLQVTDYFEHFQIYKALESVVACVRQTNGFFQRHTPWK
LCRDNPAEKCWLNTVLHVTLECLRIYGILLQPVIPATADKLLSRLGIKLEERAFTDLTFL
PRYHGKPCPFEGRRLGPDTGALFPRLETPRRRQLEIKGLRP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgttaccggcgcgctgccttctccgtccgccgcggcgtccgctcccggcccct
ttccggtggggaagctccggacccggccgccgctggcttctctccaccccgatcttctat
gtgaacgggccgccgcacatcgggcacctctactcggcgctgctggccgacgcgctgcac
cgacatcggggcctgctggggccgggcccgggccgcctcgccactgggacggacgagcac
gggctgaagatccagcaggcggcggcagcggccgggacgtctccttctgagctctgcgcg
cacgtgtccggcctgttccgcgaccttttttcccgggctgccgtctccttcaccgacttc
atccgcaccacggagccgcgccaccaccgggcggtgcagtgcttctgggcggcgctgcag
ggccgcgggctactctacaaggacttttacgagggctggtactgcaccccggatgagtgc
ttcctgacccagggccagatcaccgagcgccccgatgcccagggccgcccctgcaaggtc
tcgctggagagcggccatcaggtgcactggaccaaagaggagaattacatgttcaagctg
tctgaatttcaagagccgttacggaagtggctccaggggaatcggcatgtcatctcccct
gagcccttctaccaggtggtgctccgatggctggaagaggacttgccagacctgtctgtc
tcccgtgagagaagccgattacagtggggtatccctgtccctggtgattcaacacaaacc
atttatgtgtgggtagatgccttggtgaactatctgactgtagcgggttaccctgatgca
caccatgcctggtggccagctgctcaccatgttgttggcaaggacatcctcaagttccat
gccatctactggccagcattactcatggctgtggggcttgatcccccagagcagatctat
gtgcactcccactggacagtccatgggcaaaagatgtcgaaaagcctgggcaatgtggtg
gatccagtggcatgtttcaagcagtacacggtggatggcttcaggtacttcctgctaagg
caaggtgtccctgagcgagactgtgactattatgaggagaaagttattaagctggtgaat
tctgagctggcggatgcgctcggggggcttctcaaccgctgtacagcccctagcatcaac
cccagtgggatttacccacatttctcagagtcgtgctttcgaaagagctctgaccacatg
gatgtggaagcctcaggtagggctttggctgaggactacgagctggtagcatcagttgat
cgcttgcctctccaagtgactgattattttgaacacttccaaatatacaaggctttagaa
tctgttgttgcatgtgtgaggcagaccaatggcttcttccagagacacacgccctggaaa
ctgtgccgagacaaccctgcagagaagtgctggcttaacacagtccttcatgtgactctg
gaatgtctgcggatttatgggattctgctgcagccagtgattccagccactgcggacaag
ttactttccaggctgggtattaagcttgaggaaagggctttcacagacttgacctttctg
cctcgctaccatggaaagccatgtccctttgaaggaagaagacttggccctgacacaggg
gccttatttcctaggctggaaacaccaagaaggcgtcagctggaaatcaaaggccttaga
ccttga

DBGET integrated database retrieval system